Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4BSZ0

Protein Details
Accession A0A2T4BSZ0   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-76TSGPRKAISKKKARKLEKKMGYEBasic
NLS Segment(s)
PositionSequence
11-74SKNRLAARAAKARKANLKRCNPANQDKVAKADRTRGARPGLLPTSGPRKAISKKKARKLEKKMG
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MANVKNPNRISKNRLAARAAKARKANLKRCNPANQDKVAKADRTRGARPGLLPTSGPRKAISKKKARKLEKKMGYELRRRMEAEGEAVMKDAPVVEEKKVQEEQEMEIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.65
3 0.63
4 0.64
5 0.66
6 0.61
7 0.57
8 0.55
9 0.56
10 0.61
11 0.64
12 0.66
13 0.66
14 0.71
15 0.72
16 0.74
17 0.78
18 0.75
19 0.75
20 0.71
21 0.67
22 0.62
23 0.56
24 0.55
25 0.48
26 0.44
27 0.36
28 0.38
29 0.37
30 0.37
31 0.38
32 0.36
33 0.35
34 0.33
35 0.33
36 0.31
37 0.27
38 0.22
39 0.2
40 0.18
41 0.23
42 0.23
43 0.22
44 0.18
45 0.21
46 0.28
47 0.37
48 0.44
49 0.48
50 0.56
51 0.65
52 0.74
53 0.8
54 0.83
55 0.84
56 0.85
57 0.84
58 0.8
59 0.78
60 0.78
61 0.75
62 0.73
63 0.71
64 0.64
65 0.59
66 0.55
67 0.48
68 0.42
69 0.35
70 0.29
71 0.24
72 0.21
73 0.17
74 0.16
75 0.15
76 0.11
77 0.1
78 0.08
79 0.06
80 0.1
81 0.12
82 0.13
83 0.2
84 0.21
85 0.26
86 0.29
87 0.29
88 0.29
89 0.29