Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4BWB2

Protein Details
Accession A0A2T4BWB2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
305-348GISHIKGRHGRRQRLRSLLRRPAALWRRRRLRLRPLRRRGGAARBasic
NLS Segment(s)
PositionSequence
308-373HIKGRHGRRQRLRSLLRRPAALWRRRRLRLRPLRRRGGAARPLQRQGHLRGPLRLARRQDRHPAAR
Subcellular Location(s) plas 10, extr 9, cyto 2, E.R. 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016161  Ald_DH/histidinol_DH  
IPR016162  Ald_DH_N  
IPR015590  Aldehyde_DH_dom  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF00171  Aldedh  
Amino Acid Sequences MERLVEQLVSLVGAVSARLGSQLDISPAAIHASIALVATLICGLIVRTASAAAIAATASRPRHYVVPPPAFPEKTKESSSSSAAVDGSSSTSIRIPGSSAIQCYAPATGHFLGAVEPATEADIDAAVAAAAEAQRAWATTTFDQRRAVLRSLMRHVMDNAEQICRVAGLDSGKTMVDAQLGEILVTVEKIQWTLAHGERALRPSRRPTNLLMAYKRNTVRYEPLGVVAALVSWNYPFHNLIGPVISALFAGDAIVVKVSEQTAWSSGYFLDIARGALAAHGHDPRLVQAVACWPETAGHLTSHRGISHIKGRHGRRQRLRSLLRRPAALWRRRRLRLRPLRRRGGAARPLQRQGHLRGPLRLARRQDRHPAARPVSRAESGPLLALHAGHRRVGVWDVGYKGCWPVQDLEEHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.06
6 0.07
7 0.07
8 0.1
9 0.11
10 0.12
11 0.13
12 0.14
13 0.13
14 0.13
15 0.13
16 0.11
17 0.09
18 0.07
19 0.07
20 0.07
21 0.07
22 0.06
23 0.05
24 0.05
25 0.05
26 0.05
27 0.04
28 0.03
29 0.03
30 0.04
31 0.05
32 0.06
33 0.06
34 0.06
35 0.07
36 0.07
37 0.07
38 0.07
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.1
45 0.12
46 0.13
47 0.15
48 0.16
49 0.22
50 0.25
51 0.33
52 0.39
53 0.46
54 0.46
55 0.51
56 0.55
57 0.52
58 0.5
59 0.48
60 0.44
61 0.41
62 0.42
63 0.4
64 0.38
65 0.4
66 0.41
67 0.37
68 0.31
69 0.27
70 0.24
71 0.21
72 0.16
73 0.13
74 0.11
75 0.1
76 0.09
77 0.08
78 0.09
79 0.11
80 0.11
81 0.11
82 0.1
83 0.11
84 0.16
85 0.17
86 0.17
87 0.17
88 0.17
89 0.17
90 0.16
91 0.15
92 0.11
93 0.09
94 0.13
95 0.13
96 0.12
97 0.12
98 0.12
99 0.11
100 0.11
101 0.11
102 0.06
103 0.05
104 0.05
105 0.06
106 0.06
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.03
113 0.03
114 0.03
115 0.02
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.04
122 0.04
123 0.06
124 0.07
125 0.11
126 0.13
127 0.23
128 0.26
129 0.29
130 0.31
131 0.31
132 0.34
133 0.34
134 0.34
135 0.3
136 0.3
137 0.31
138 0.34
139 0.37
140 0.32
141 0.29
142 0.28
143 0.25
144 0.23
145 0.21
146 0.18
147 0.15
148 0.14
149 0.13
150 0.12
151 0.1
152 0.09
153 0.06
154 0.06
155 0.07
156 0.07
157 0.07
158 0.08
159 0.08
160 0.08
161 0.08
162 0.07
163 0.06
164 0.06
165 0.06
166 0.07
167 0.07
168 0.07
169 0.06
170 0.06
171 0.05
172 0.05
173 0.05
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.06
180 0.09
181 0.1
182 0.12
183 0.12
184 0.14
185 0.16
186 0.2
187 0.23
188 0.22
189 0.23
190 0.3
191 0.37
192 0.39
193 0.39
194 0.38
195 0.42
196 0.46
197 0.49
198 0.44
199 0.41
200 0.39
201 0.42
202 0.41
203 0.35
204 0.3
205 0.28
206 0.28
207 0.26
208 0.27
209 0.22
210 0.22
211 0.19
212 0.18
213 0.15
214 0.11
215 0.08
216 0.05
217 0.04
218 0.04
219 0.03
220 0.04
221 0.04
222 0.05
223 0.06
224 0.07
225 0.09
226 0.09
227 0.1
228 0.1
229 0.1
230 0.08
231 0.08
232 0.07
233 0.05
234 0.04
235 0.04
236 0.03
237 0.03
238 0.03
239 0.03
240 0.03
241 0.03
242 0.03
243 0.03
244 0.04
245 0.04
246 0.04
247 0.05
248 0.06
249 0.07
250 0.09
251 0.09
252 0.09
253 0.08
254 0.09
255 0.09
256 0.08
257 0.08
258 0.07
259 0.07
260 0.06
261 0.07
262 0.06
263 0.06
264 0.06
265 0.06
266 0.08
267 0.09
268 0.09
269 0.1
270 0.1
271 0.1
272 0.14
273 0.13
274 0.1
275 0.1
276 0.17
277 0.18
278 0.19
279 0.18
280 0.14
281 0.15
282 0.16
283 0.18
284 0.13
285 0.12
286 0.13
287 0.15
288 0.18
289 0.19
290 0.18
291 0.17
292 0.17
293 0.19
294 0.27
295 0.3
296 0.34
297 0.41
298 0.46
299 0.55
300 0.64
301 0.7
302 0.72
303 0.76
304 0.78
305 0.8
306 0.84
307 0.84
308 0.84
309 0.84
310 0.77
311 0.69
312 0.62
313 0.62
314 0.63
315 0.62
316 0.61
317 0.61
318 0.67
319 0.74
320 0.82
321 0.81
322 0.82
323 0.85
324 0.87
325 0.88
326 0.89
327 0.9
328 0.84
329 0.82
330 0.77
331 0.76
332 0.74
333 0.72
334 0.7
335 0.66
336 0.7
337 0.65
338 0.63
339 0.58
340 0.55
341 0.55
342 0.54
343 0.52
344 0.5
345 0.53
346 0.54
347 0.55
348 0.55
349 0.55
350 0.57
351 0.6
352 0.63
353 0.68
354 0.72
355 0.74
356 0.77
357 0.78
358 0.75
359 0.74
360 0.7
361 0.66
362 0.62
363 0.55
364 0.47
365 0.4
366 0.36
367 0.3
368 0.29
369 0.22
370 0.18
371 0.17
372 0.16
373 0.17
374 0.21
375 0.22
376 0.21
377 0.21
378 0.21
379 0.23
380 0.24
381 0.23
382 0.19
383 0.22
384 0.24
385 0.24
386 0.25
387 0.23
388 0.24
389 0.23
390 0.21
391 0.2
392 0.21
393 0.23