Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4CGN3

Protein Details
Accession A0A2T4CGN3    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-54RHEHRGSTPLKREKKRTDESIHQRERRRDTRRLDRGSRQKLQBasic
NLS Segment(s)
PositionSequence
19-52STPLKREKKRTDESIHQRERRRDTRRLDRGSRQK
Subcellular Location(s) mito 16.5, cyto_mito 10.5, nucl 7
Family & Domain DBs
Amino Acid Sequences MLFFSGFFRQPIRHEHRGSTPLKREKKRTDESIHQRERRRDTRRLDRGSRQKLQLTSHGRSRRGLARTVLCWMQCEDETETGGSMTTRSRGSLRRLAWLRVDGEDEERYRYLLDMLVICLNLEDTVLRGVRGKAIYSNIQERTLDWDDGTMADGDGGAARSMWRADRAEQDDGCWASGALISARPTAQAGKRILV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.56
4 0.61
5 0.63
6 0.62
7 0.63
8 0.64
9 0.71
10 0.75
11 0.77
12 0.79
13 0.84
14 0.83
15 0.82
16 0.8
17 0.81
18 0.83
19 0.84
20 0.84
21 0.81
22 0.81
23 0.8
24 0.81
25 0.81
26 0.77
27 0.75
28 0.75
29 0.79
30 0.81
31 0.81
32 0.79
33 0.8
34 0.83
35 0.83
36 0.8
37 0.73
38 0.69
39 0.63
40 0.59
41 0.58
42 0.55
43 0.49
44 0.51
45 0.53
46 0.49
47 0.47
48 0.48
49 0.46
50 0.41
51 0.41
52 0.37
53 0.34
54 0.34
55 0.36
56 0.33
57 0.26
58 0.24
59 0.21
60 0.18
61 0.15
62 0.17
63 0.16
64 0.14
65 0.15
66 0.13
67 0.12
68 0.1
69 0.1
70 0.07
71 0.06
72 0.05
73 0.07
74 0.07
75 0.08
76 0.11
77 0.15
78 0.2
79 0.26
80 0.27
81 0.33
82 0.35
83 0.36
84 0.35
85 0.32
86 0.28
87 0.22
88 0.22
89 0.15
90 0.15
91 0.16
92 0.15
93 0.14
94 0.13
95 0.13
96 0.12
97 0.11
98 0.09
99 0.08
100 0.08
101 0.07
102 0.07
103 0.08
104 0.08
105 0.07
106 0.07
107 0.06
108 0.05
109 0.04
110 0.03
111 0.03
112 0.06
113 0.06
114 0.07
115 0.08
116 0.08
117 0.12
118 0.13
119 0.13
120 0.13
121 0.16
122 0.21
123 0.22
124 0.28
125 0.27
126 0.28
127 0.27
128 0.26
129 0.3
130 0.29
131 0.26
132 0.2
133 0.18
134 0.17
135 0.17
136 0.17
137 0.1
138 0.06
139 0.06
140 0.05
141 0.05
142 0.05
143 0.06
144 0.05
145 0.05
146 0.05
147 0.06
148 0.08
149 0.09
150 0.13
151 0.15
152 0.18
153 0.26
154 0.31
155 0.36
156 0.35
157 0.35
158 0.36
159 0.35
160 0.32
161 0.24
162 0.19
163 0.13
164 0.14
165 0.14
166 0.09
167 0.11
168 0.12
169 0.14
170 0.14
171 0.14
172 0.15
173 0.2
174 0.24
175 0.29