Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4QZ82

Protein Details
Accession C4QZ82    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
137-158QDLASSKKRIKKITKYVKIEYPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019371  KxDL_dom  
Gene Ontology GO:0005768  C:endosome  
KEGG ppa:PAS_FragB_0026  -  
Pfam View protein in Pfam  
PF10241  KxDL  
Amino Acid Sequences MPRSPSVDSASFALDPVEYSYDPIDDQSDSDSSISSQNDFRAFRNNPSSREQRSDLNKYSKRDGSDFSPVDYLINSINASLKSVALDKAMVIQSQLSGELNNQNDLVLKKLLELETRLKSHLVKYQQAKKVILQINQDLASSKKRIKKITKYVKIEYPIEYSKAYNKVNNNITNDEEDLYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.14
5 0.11
6 0.12
7 0.13
8 0.13
9 0.13
10 0.13
11 0.13
12 0.1
13 0.1
14 0.12
15 0.11
16 0.12
17 0.12
18 0.11
19 0.1
20 0.14
21 0.14
22 0.14
23 0.15
24 0.17
25 0.22
26 0.23
27 0.23
28 0.29
29 0.3
30 0.35
31 0.43
32 0.45
33 0.44
34 0.49
35 0.56
36 0.51
37 0.55
38 0.51
39 0.48
40 0.51
41 0.55
42 0.56
43 0.58
44 0.59
45 0.57
46 0.61
47 0.57
48 0.52
49 0.46
50 0.41
51 0.36
52 0.39
53 0.36
54 0.31
55 0.28
56 0.25
57 0.23
58 0.2
59 0.16
60 0.07
61 0.08
62 0.06
63 0.06
64 0.08
65 0.07
66 0.08
67 0.08
68 0.08
69 0.07
70 0.08
71 0.08
72 0.07
73 0.07
74 0.06
75 0.09
76 0.09
77 0.08
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.04
84 0.04
85 0.05
86 0.09
87 0.1
88 0.1
89 0.1
90 0.1
91 0.12
92 0.12
93 0.13
94 0.1
95 0.09
96 0.09
97 0.11
98 0.12
99 0.11
100 0.14
101 0.18
102 0.21
103 0.23
104 0.23
105 0.22
106 0.23
107 0.24
108 0.28
109 0.28
110 0.3
111 0.37
112 0.46
113 0.51
114 0.54
115 0.53
116 0.48
117 0.53
118 0.51
119 0.47
120 0.42
121 0.38
122 0.37
123 0.36
124 0.34
125 0.26
126 0.23
127 0.23
128 0.23
129 0.27
130 0.31
131 0.37
132 0.46
133 0.55
134 0.64
135 0.7
136 0.78
137 0.81
138 0.82
139 0.81
140 0.79
141 0.75
142 0.66
143 0.58
144 0.53
145 0.46
146 0.41
147 0.36
148 0.31
149 0.32
150 0.37
151 0.37
152 0.37
153 0.4
154 0.46
155 0.53
156 0.58
157 0.57
158 0.53
159 0.52
160 0.5
161 0.45