Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4CF97

Protein Details
Accession A0A2T4CF97    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-34ISQFDKLPSKRKPCVRDNGFTEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002466  A_deamin  
IPR042935  Tad1  
Gene Ontology GO:0003723  F:RNA binding  
GO:0008251  F:tRNA-specific adenosine deaminase activity  
GO:0002100  P:tRNA wobble adenosine to inosine editing  
Pfam View protein in Pfam  
PF02137  A_deamin  
PROSITE View protein in PROSITE  
PS50141  A_DEAMIN_EDITASE  
Amino Acid Sequences MTSRANLIARTVISQFDKLPSKRKPCVRDNGFTEWVPLSGIVAERNGVLTCLALATGMKCLPASKLAEAKGVAIHDWHAEVLAIRTFNRFMLDECQTLIESNCHEHESILQRGHPWGLDAEDGRFTRPFVVKEGVKLHMYCSEAPCGDASMELIMAAQADASPWQLPAPQPLSSSASTDAEQNPTAQLPGRAYFSQLGIVRRKPARGDAPPTLSKSCSDKISLKQCTSLLSSLASLFVDPANAYIDTLVLPESQYSAAACERAFSPAGRMKPVAGKQWPGGYAFRPFKVEATSVEFAFSKRAVQARSQAISASNLAATWSASGVEESILGGVLQGRKQFDVRGASKSSRRQMWNKAKQLSECLSTPSSVSGPDKDAENVPDDDRHRALQEHLSSASSYQEVKDGPLLDERRHVKAQTRELALKGWVQTEGDSDFGIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.28
4 0.36
5 0.37
6 0.46
7 0.51
8 0.58
9 0.65
10 0.73
11 0.74
12 0.75
13 0.82
14 0.81
15 0.81
16 0.77
17 0.77
18 0.72
19 0.63
20 0.56
21 0.46
22 0.38
23 0.29
24 0.22
25 0.14
26 0.11
27 0.12
28 0.1
29 0.1
30 0.1
31 0.1
32 0.11
33 0.11
34 0.09
35 0.08
36 0.07
37 0.07
38 0.06
39 0.06
40 0.05
41 0.06
42 0.06
43 0.09
44 0.09
45 0.09
46 0.09
47 0.1
48 0.12
49 0.17
50 0.19
51 0.2
52 0.26
53 0.26
54 0.3
55 0.29
56 0.29
57 0.26
58 0.23
59 0.19
60 0.14
61 0.14
62 0.11
63 0.12
64 0.1
65 0.08
66 0.08
67 0.08
68 0.09
69 0.11
70 0.11
71 0.11
72 0.13
73 0.14
74 0.14
75 0.16
76 0.14
77 0.14
78 0.19
79 0.22
80 0.21
81 0.2
82 0.21
83 0.19
84 0.19
85 0.18
86 0.14
87 0.12
88 0.15
89 0.15
90 0.15
91 0.15
92 0.15
93 0.2
94 0.23
95 0.27
96 0.26
97 0.25
98 0.25
99 0.26
100 0.27
101 0.21
102 0.16
103 0.12
104 0.12
105 0.13
106 0.12
107 0.12
108 0.16
109 0.16
110 0.17
111 0.17
112 0.16
113 0.19
114 0.22
115 0.22
116 0.21
117 0.27
118 0.25
119 0.3
120 0.33
121 0.3
122 0.29
123 0.28
124 0.25
125 0.24
126 0.25
127 0.22
128 0.21
129 0.21
130 0.19
131 0.19
132 0.18
133 0.15
134 0.12
135 0.1
136 0.09
137 0.06
138 0.05
139 0.05
140 0.04
141 0.03
142 0.03
143 0.03
144 0.03
145 0.02
146 0.03
147 0.03
148 0.04
149 0.05
150 0.05
151 0.05
152 0.07
153 0.08
154 0.12
155 0.15
156 0.15
157 0.16
158 0.18
159 0.22
160 0.2
161 0.21
162 0.18
163 0.17
164 0.16
165 0.18
166 0.17
167 0.15
168 0.15
169 0.14
170 0.13
171 0.12
172 0.12
173 0.1
174 0.1
175 0.09
176 0.1
177 0.13
178 0.13
179 0.14
180 0.15
181 0.14
182 0.17
183 0.18
184 0.21
185 0.22
186 0.23
187 0.27
188 0.28
189 0.29
190 0.26
191 0.29
192 0.31
193 0.32
194 0.37
195 0.35
196 0.39
197 0.4
198 0.42
199 0.38
200 0.31
201 0.28
202 0.26
203 0.24
204 0.2
205 0.2
206 0.22
207 0.27
208 0.35
209 0.38
210 0.35
211 0.35
212 0.34
213 0.32
214 0.3
215 0.25
216 0.16
217 0.12
218 0.12
219 0.1
220 0.1
221 0.08
222 0.06
223 0.06
224 0.05
225 0.05
226 0.04
227 0.05
228 0.06
229 0.06
230 0.06
231 0.05
232 0.06
233 0.05
234 0.06
235 0.06
236 0.04
237 0.04
238 0.04
239 0.05
240 0.05
241 0.05
242 0.05
243 0.06
244 0.07
245 0.08
246 0.07
247 0.07
248 0.08
249 0.1
250 0.1
251 0.09
252 0.14
253 0.17
254 0.19
255 0.2
256 0.2
257 0.2
258 0.26
259 0.29
260 0.3
261 0.28
262 0.29
263 0.29
264 0.31
265 0.31
266 0.27
267 0.25
268 0.2
269 0.26
270 0.26
271 0.26
272 0.26
273 0.25
274 0.24
275 0.25
276 0.24
277 0.18
278 0.23
279 0.23
280 0.2
281 0.21
282 0.2
283 0.18
284 0.19
285 0.17
286 0.11
287 0.13
288 0.16
289 0.17
290 0.2
291 0.27
292 0.3
293 0.32
294 0.31
295 0.28
296 0.26
297 0.26
298 0.23
299 0.17
300 0.11
301 0.09
302 0.09
303 0.09
304 0.08
305 0.06
306 0.05
307 0.05
308 0.05
309 0.05
310 0.05
311 0.05
312 0.05
313 0.05
314 0.05
315 0.04
316 0.04
317 0.04
318 0.06
319 0.08
320 0.1
321 0.13
322 0.14
323 0.16
324 0.17
325 0.18
326 0.21
327 0.28
328 0.28
329 0.31
330 0.35
331 0.39
332 0.45
333 0.51
334 0.53
335 0.53
336 0.58
337 0.6
338 0.66
339 0.72
340 0.76
341 0.77
342 0.76
343 0.73
344 0.68
345 0.67
346 0.6
347 0.52
348 0.42
349 0.38
350 0.33
351 0.29
352 0.27
353 0.22
354 0.19
355 0.18
356 0.2
357 0.18
358 0.19
359 0.2
360 0.21
361 0.21
362 0.24
363 0.22
364 0.23
365 0.23
366 0.22
367 0.27
368 0.27
369 0.3
370 0.29
371 0.29
372 0.28
373 0.27
374 0.29
375 0.32
376 0.33
377 0.31
378 0.3
379 0.29
380 0.28
381 0.26
382 0.25
383 0.18
384 0.16
385 0.13
386 0.16
387 0.15
388 0.16
389 0.2
390 0.19
391 0.2
392 0.27
393 0.3
394 0.28
395 0.36
396 0.38
397 0.4
398 0.43
399 0.44
400 0.44
401 0.5
402 0.58
403 0.58
404 0.61
405 0.58
406 0.55
407 0.56
408 0.49
409 0.44
410 0.37
411 0.3
412 0.25
413 0.22
414 0.21
415 0.21
416 0.2
417 0.16