Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4CBW2

Protein Details
Accession A0A2T4CBW2    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-45MRTRKHQKAKRENRMPRLCKRKSRRPWKRQPRPQKGKLRTREVREBasic
NLS Segment(s)
PositionSequence
4-41RKHQKAKRENRMPRLCKRKSRRPWKRQPRPQKGKLRTR
Subcellular Location(s) nucl 21, mito_nucl 13.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MRTRKHQKAKRENRMPRLCKRKSRRPWKRQPRPQKGKLRTREVREYVKHVKPDPPESDNAFSGTLLLSALLGQVSSRRSKMDNRVDSQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.91
3 0.89
4 0.89
5 0.86
6 0.86
7 0.86
8 0.86
9 0.86
10 0.89
11 0.9
12 0.91
13 0.93
14 0.94
15 0.96
16 0.96
17 0.96
18 0.96
19 0.95
20 0.94
21 0.93
22 0.92
23 0.9
24 0.88
25 0.86
26 0.82
27 0.78
28 0.76
29 0.7
30 0.67
31 0.59
32 0.57
33 0.55
34 0.52
35 0.49
36 0.43
37 0.43
38 0.4
39 0.45
40 0.42
41 0.37
42 0.37
43 0.37
44 0.38
45 0.33
46 0.31
47 0.25
48 0.19
49 0.17
50 0.13
51 0.09
52 0.06
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.03
59 0.03
60 0.06
61 0.1
62 0.13
63 0.15
64 0.17
65 0.21
66 0.29
67 0.39
68 0.48
69 0.54