Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4CGI6

Protein Details
Accession A0A2T4CGI6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-86CVDERERREGTRRKKKRKRICCGQWVYKLVBasic
NLS Segment(s)
PositionSequence
63-75RREGTRRKKKRKR
Subcellular Location(s) cyto 12.5, cyto_nucl 7.5, mito 6, extr 2, pero 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MLVPGLLLPGWRDGAGWFDRASKLPRIWMTERLAEVGSELCRLGEKCVCVCVCVCGCVDERERREGTRRKKKRKRICCGQWVYKLVGALICRALLSSLLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.16
4 0.15
5 0.16
6 0.18
7 0.21
8 0.24
9 0.25
10 0.25
11 0.29
12 0.32
13 0.36
14 0.37
15 0.41
16 0.41
17 0.39
18 0.38
19 0.33
20 0.3
21 0.23
22 0.2
23 0.15
24 0.12
25 0.09
26 0.08
27 0.07
28 0.08
29 0.08
30 0.1
31 0.1
32 0.11
33 0.11
34 0.15
35 0.15
36 0.14
37 0.14
38 0.14
39 0.12
40 0.12
41 0.12
42 0.1
43 0.11
44 0.14
45 0.19
46 0.23
47 0.25
48 0.29
49 0.3
50 0.3
51 0.38
52 0.44
53 0.51
54 0.56
55 0.65
56 0.71
57 0.8
58 0.9
59 0.92
60 0.94
61 0.93
62 0.93
63 0.93
64 0.92
65 0.91
66 0.89
67 0.86
68 0.78
69 0.7
70 0.6
71 0.5
72 0.39
73 0.32
74 0.24
75 0.18
76 0.16
77 0.13
78 0.11
79 0.11
80 0.11
81 0.09