Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4CBL0

Protein Details
Accession A0A2T4CBL0   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
208-233AANGGSRKPGRPKKDKKAAPVVGRTLHydrophilic
NLS Segment(s)
PositionSequence
205-235GKAAANGGSRKPGRPKKDKKAAPVVGRTLRK
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MGADTAKPEAPAESSAPSEKPKELPIVADTKAPEDAKPAQEPPSAADAFKESHKPPHAVEVQSVPETPVNASTPAGGSPRPELPISAEPEESEKPKEDPVLITEVQEPLPTPSASAPGSDVGPDSIVDKPAAPNGESKPAELMAGALQTGNAEDKSETSSTAAGEKRKQPDTADAEATPDEAAAEKEDSEESERADKKVKIDENGKAAANGGSRKPGRPKKDKKAAPVVGRTLRKTRSQGPVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.23
4 0.26
5 0.27
6 0.27
7 0.28
8 0.29
9 0.32
10 0.3
11 0.31
12 0.31
13 0.32
14 0.3
15 0.31
16 0.28
17 0.24
18 0.28
19 0.26
20 0.22
21 0.22
22 0.27
23 0.28
24 0.31
25 0.31
26 0.31
27 0.32
28 0.33
29 0.31
30 0.32
31 0.28
32 0.24
33 0.22
34 0.2
35 0.19
36 0.22
37 0.25
38 0.2
39 0.27
40 0.32
41 0.33
42 0.32
43 0.39
44 0.42
45 0.37
46 0.38
47 0.33
48 0.32
49 0.31
50 0.3
51 0.22
52 0.18
53 0.17
54 0.15
55 0.14
56 0.12
57 0.12
58 0.12
59 0.11
60 0.11
61 0.11
62 0.12
63 0.1
64 0.1
65 0.12
66 0.14
67 0.15
68 0.15
69 0.14
70 0.18
71 0.22
72 0.25
73 0.24
74 0.22
75 0.21
76 0.24
77 0.25
78 0.22
79 0.19
80 0.16
81 0.16
82 0.17
83 0.18
84 0.15
85 0.14
86 0.14
87 0.18
88 0.16
89 0.16
90 0.16
91 0.15
92 0.15
93 0.14
94 0.12
95 0.09
96 0.11
97 0.09
98 0.09
99 0.08
100 0.11
101 0.11
102 0.11
103 0.1
104 0.08
105 0.09
106 0.08
107 0.08
108 0.05
109 0.06
110 0.05
111 0.06
112 0.06
113 0.07
114 0.07
115 0.07
116 0.07
117 0.09
118 0.1
119 0.09
120 0.12
121 0.13
122 0.21
123 0.21
124 0.21
125 0.2
126 0.19
127 0.18
128 0.15
129 0.14
130 0.06
131 0.06
132 0.05
133 0.04
134 0.04
135 0.04
136 0.04
137 0.05
138 0.04
139 0.05
140 0.05
141 0.06
142 0.09
143 0.09
144 0.1
145 0.09
146 0.1
147 0.1
148 0.15
149 0.17
150 0.18
151 0.23
152 0.29
153 0.34
154 0.36
155 0.37
156 0.34
157 0.4
158 0.43
159 0.42
160 0.39
161 0.33
162 0.32
163 0.3
164 0.28
165 0.19
166 0.13
167 0.09
168 0.06
169 0.07
170 0.07
171 0.07
172 0.07
173 0.08
174 0.08
175 0.1
176 0.13
177 0.13
178 0.14
179 0.21
180 0.23
181 0.24
182 0.3
183 0.3
184 0.3
185 0.38
186 0.41
187 0.4
188 0.44
189 0.48
190 0.47
191 0.48
192 0.45
193 0.36
194 0.32
195 0.28
196 0.25
197 0.23
198 0.2
199 0.25
200 0.27
201 0.33
202 0.43
203 0.5
204 0.57
205 0.64
206 0.74
207 0.77
208 0.86
209 0.87
210 0.86
211 0.88
212 0.86
213 0.84
214 0.8
215 0.78
216 0.76
217 0.75
218 0.7
219 0.67
220 0.63
221 0.62
222 0.61
223 0.61
224 0.62