Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4CJF5

Protein Details
Accession A0A2T4CJF5    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MVSHRVTYRRRNGYNTRSNRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MVSHRVTYRRRNGYNTRSNRTRVIKTPGGDIRLLHIKKRGTAPKCGDCGAKLPGVPALRPREYSQISKPKKTVQRAYGGSRCGGCVRDRIVRAFLIEEQKIVKKVMKEQEASQKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.79
4 0.75
5 0.73
6 0.73
7 0.7
8 0.66
9 0.62
10 0.61
11 0.58
12 0.52
13 0.57
14 0.52
15 0.48
16 0.42
17 0.35
18 0.31
19 0.35
20 0.34
21 0.29
22 0.3
23 0.28
24 0.31
25 0.39
26 0.44
27 0.38
28 0.46
29 0.51
30 0.52
31 0.53
32 0.51
33 0.43
34 0.35
35 0.35
36 0.28
37 0.22
38 0.16
39 0.14
40 0.16
41 0.16
42 0.15
43 0.18
44 0.21
45 0.21
46 0.23
47 0.24
48 0.27
49 0.29
50 0.32
51 0.35
52 0.41
53 0.44
54 0.46
55 0.47
56 0.49
57 0.54
58 0.59
59 0.58
60 0.53
61 0.57
62 0.58
63 0.63
64 0.59
65 0.53
66 0.46
67 0.38
68 0.34
69 0.27
70 0.25
71 0.18
72 0.18
73 0.21
74 0.26
75 0.28
76 0.29
77 0.3
78 0.29
79 0.28
80 0.26
81 0.27
82 0.26
83 0.24
84 0.23
85 0.24
86 0.27
87 0.28
88 0.27
89 0.27
90 0.24
91 0.33
92 0.41
93 0.45
94 0.44
95 0.49
96 0.58