Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4C3G1

Protein Details
Accession A0A2T4C3G1    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
78-98EAPKKPAKKEAKKPAAKKEESBasic
NLS Segment(s)
PositionSequence
18-46PVKAAVASKGKSAAKKVVKEEPSKKSKKA
80-95PKKPAKKEAKKPAAKK
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MGKSTKVKESKKVVAAEPVKAAVASKGKSAAKKVVKEEPSKKSKKAEPESSDESSSEEEEDSDSASESDSDSASSEEEAPKKPAKKEAKKPAAKKEESESESESESESDSDDSESDEEETKKPAVNGKAKAESESESESDSDEESDEEEKPAAKVSQSHTCIHST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.58
3 0.52
4 0.45
5 0.37
6 0.3
7 0.26
8 0.24
9 0.19
10 0.21
11 0.19
12 0.18
13 0.24
14 0.27
15 0.3
16 0.34
17 0.39
18 0.41
19 0.46
20 0.49
21 0.52
22 0.55
23 0.62
24 0.66
25 0.66
26 0.69
27 0.69
28 0.68
29 0.66
30 0.65
31 0.67
32 0.68
33 0.68
34 0.63
35 0.65
36 0.66
37 0.62
38 0.57
39 0.46
40 0.38
41 0.29
42 0.25
43 0.18
44 0.11
45 0.09
46 0.08
47 0.08
48 0.07
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.06
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.06
62 0.07
63 0.09
64 0.11
65 0.12
66 0.14
67 0.18
68 0.22
69 0.23
70 0.31
71 0.39
72 0.47
73 0.56
74 0.64
75 0.7
76 0.75
77 0.8
78 0.81
79 0.8
80 0.72
81 0.64
82 0.58
83 0.56
84 0.5
85 0.46
86 0.38
87 0.29
88 0.28
89 0.26
90 0.21
91 0.13
92 0.12
93 0.09
94 0.08
95 0.07
96 0.07
97 0.07
98 0.06
99 0.07
100 0.07
101 0.07
102 0.08
103 0.1
104 0.12
105 0.12
106 0.14
107 0.14
108 0.16
109 0.16
110 0.22
111 0.27
112 0.33
113 0.38
114 0.42
115 0.49
116 0.48
117 0.48
118 0.44
119 0.38
120 0.33
121 0.31
122 0.25
123 0.19
124 0.18
125 0.18
126 0.16
127 0.15
128 0.12
129 0.09
130 0.09
131 0.09
132 0.11
133 0.11
134 0.11
135 0.11
136 0.11
137 0.11
138 0.15
139 0.14
140 0.14
141 0.18
142 0.23
143 0.33
144 0.36
145 0.38