Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4BVZ2

Protein Details
Accession A0A2T4BVZ2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
44-65AIPERVKKSRKGERKRDREIVMBasic
NLS Segment(s)
PositionSequence
48-59RVKKSRKGERKR
Subcellular Location(s) plas 18, E.R. 4, golg 3
Family & Domain DBs
Amino Acid Sequences MLFFPCQLVLCLVFPISFSLGGLEWSRGRTNSRLMDYVALSRLAIPERVKKSRKGERKRDREIVMLNMLCSFFGSWDMYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.11
4 0.09
5 0.08
6 0.08
7 0.08
8 0.1
9 0.1
10 0.1
11 0.1
12 0.13
13 0.14
14 0.14
15 0.17
16 0.18
17 0.23
18 0.26
19 0.28
20 0.27
21 0.26
22 0.26
23 0.24
24 0.23
25 0.18
26 0.13
27 0.1
28 0.09
29 0.09
30 0.08
31 0.1
32 0.11
33 0.18
34 0.24
35 0.32
36 0.35
37 0.41
38 0.5
39 0.57
40 0.66
41 0.69
42 0.75
43 0.78
44 0.85
45 0.87
46 0.86
47 0.79
48 0.75
49 0.67
50 0.61
51 0.57
52 0.48
53 0.39
54 0.32
55 0.29
56 0.23
57 0.2
58 0.15
59 0.08
60 0.1