Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4BYU6

Protein Details
Accession A0A2T4BYU6    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
25-52SLEMDKKGKREREKRERERERDRWRKTABasic
81-103DYGPKFPRCPLQRRFKRKRDQRNBasic
NLS Segment(s)
PositionSequence
30-55KKGKREREKRERERERDRWRKTATKK
94-99RFKRKR
Subcellular Location(s) nucl 18.5, mito_nucl 13, mito 6.5
Family & Domain DBs
Amino Acid Sequences MYKRTLRTRDAPFQPRQTCSEDGLSLEMDKKGKREREKRERERERDRWRKTATKKMALPYEKYAKILPYFSSISLPSFLSDYGPKFPRCPLQRRFKRKRDQRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.68
3 0.64
4 0.59
5 0.52
6 0.47
7 0.42
8 0.33
9 0.28
10 0.26
11 0.22
12 0.18
13 0.17
14 0.16
15 0.15
16 0.15
17 0.19
18 0.25
19 0.33
20 0.42
21 0.5
22 0.59
23 0.68
24 0.78
25 0.84
26 0.88
27 0.9
28 0.89
29 0.9
30 0.89
31 0.89
32 0.88
33 0.82
34 0.79
35 0.75
36 0.75
37 0.71
38 0.71
39 0.67
40 0.64
41 0.62
42 0.59
43 0.61
44 0.55
45 0.51
46 0.46
47 0.46
48 0.39
49 0.37
50 0.34
51 0.28
52 0.27
53 0.25
54 0.21
55 0.18
56 0.18
57 0.18
58 0.19
59 0.17
60 0.16
61 0.16
62 0.16
63 0.12
64 0.11
65 0.11
66 0.11
67 0.13
68 0.15
69 0.2
70 0.25
71 0.26
72 0.27
73 0.31
74 0.38
75 0.43
76 0.51
77 0.54
78 0.6
79 0.7
80 0.79
81 0.87
82 0.87
83 0.91