Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4CH67

Protein Details
Accession A0A2T4CH67    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
77-102SQTCVRERDFRHKRRIRQLWLLPKLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 8
Family & Domain DBs
Amino Acid Sequences MYARNHLCSPQISSSNRSKRDISTHRCCRKHLPVVQSIHHASLTCTTTILSCHEDLPCQSPFPFLFPHRKPQPQPQSQTCVRERDFRHKRRIRQLWLLPKLSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.55
3 0.58
4 0.56
5 0.52
6 0.49
7 0.56
8 0.61
9 0.6
10 0.61
11 0.67
12 0.73
13 0.74
14 0.73
15 0.71
16 0.71
17 0.71
18 0.67
19 0.62
20 0.6
21 0.62
22 0.6
23 0.56
24 0.47
25 0.39
26 0.32
27 0.26
28 0.18
29 0.18
30 0.17
31 0.12
32 0.11
33 0.1
34 0.1
35 0.11
36 0.12
37 0.1
38 0.09
39 0.1
40 0.11
41 0.11
42 0.12
43 0.14
44 0.13
45 0.12
46 0.11
47 0.13
48 0.13
49 0.15
50 0.17
51 0.17
52 0.27
53 0.28
54 0.38
55 0.43
56 0.51
57 0.53
58 0.6
59 0.68
60 0.67
61 0.73
62 0.69
63 0.69
64 0.67
65 0.7
66 0.63
67 0.6
68 0.54
69 0.54
70 0.54
71 0.57
72 0.63
73 0.64
74 0.71
75 0.72
76 0.8
77 0.83
78 0.88
79 0.85
80 0.85
81 0.86
82 0.86
83 0.85