Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4BPZ0

Protein Details
Accession A0A2T4BPZ0   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAKSSRSSSKKFNNQRKAASIFHydrophilic
75-120DVDSKKPTRPQITKKRIEKKRKKSSITFPKYSDRLAARKKKNAPKKBasic
NLS Segment(s)
PositionSequence
79-120KKPTRPQITKKRIEKKRKKSSITFPKYSDRLAARKKKNAPKK
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRSSSKKFNNQRKAASIFGPAETARQERLSAKLLELAKQAKPEPAEMKIDGDESDNAQDREDQAADETSMDVDSKKPTRPQITKKRIEKKRKKSSITFPKYSDRLAARKKKNAPKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.8
4 0.74
5 0.66
6 0.57
7 0.52
8 0.42
9 0.35
10 0.31
11 0.24
12 0.21
13 0.2
14 0.2
15 0.16
16 0.15
17 0.17
18 0.16
19 0.2
20 0.22
21 0.2
22 0.19
23 0.23
24 0.23
25 0.23
26 0.25
27 0.24
28 0.21
29 0.23
30 0.24
31 0.21
32 0.21
33 0.23
34 0.22
35 0.21
36 0.23
37 0.2
38 0.21
39 0.18
40 0.18
41 0.15
42 0.13
43 0.11
44 0.09
45 0.1
46 0.11
47 0.1
48 0.1
49 0.1
50 0.1
51 0.11
52 0.11
53 0.09
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.05
60 0.05
61 0.06
62 0.05
63 0.06
64 0.11
65 0.13
66 0.17
67 0.21
68 0.28
69 0.38
70 0.47
71 0.56
72 0.63
73 0.71
74 0.77
75 0.83
76 0.87
77 0.87
78 0.9
79 0.91
80 0.9
81 0.91
82 0.92
83 0.89
84 0.88
85 0.88
86 0.88
87 0.86
88 0.81
89 0.74
90 0.73
91 0.68
92 0.6
93 0.56
94 0.51
95 0.51
96 0.55
97 0.61
98 0.62
99 0.69
100 0.78