Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4C6K5

Protein Details
Accession A0A2T4C6K5   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-63LADRQRRGTTKQKQRPNRDKDSLARRRREKGQTKRQVGKPBasic
NLS Segment(s)
PositionSequence
27-75RQRRGTTKQKQRPNRDKDSLARRRREKGQTKRQVGKPVEKKVRQARPPP
Subcellular Location(s) mito 16, nucl 7, cyto_nucl 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MAARSRSTRQRLHLAFAQVGRERLADRQRRGTTKQKQRPNRDKDSLARRRREKGQTKRQVGKPVEKKVRQARPPPSHKILSPQVSLPVLFVCVCVSLSSFTVLRPQPVAEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.51
3 0.46
4 0.45
5 0.37
6 0.36
7 0.3
8 0.25
9 0.22
10 0.25
11 0.33
12 0.36
13 0.38
14 0.47
15 0.52
16 0.56
17 0.61
18 0.65
19 0.66
20 0.69
21 0.74
22 0.74
23 0.78
24 0.84
25 0.89
26 0.87
27 0.86
28 0.8
29 0.76
30 0.74
31 0.75
32 0.74
33 0.72
34 0.72
35 0.67
36 0.66
37 0.69
38 0.71
39 0.71
40 0.71
41 0.74
42 0.76
43 0.79
44 0.82
45 0.78
46 0.77
47 0.7
48 0.69
49 0.66
50 0.66
51 0.68
52 0.62
53 0.66
54 0.66
55 0.72
56 0.7
57 0.7
58 0.71
59 0.72
60 0.76
61 0.76
62 0.72
63 0.66
64 0.59
65 0.57
66 0.55
67 0.49
68 0.43
69 0.37
70 0.34
71 0.32
72 0.31
73 0.24
74 0.17
75 0.13
76 0.11
77 0.11
78 0.08
79 0.07
80 0.08
81 0.08
82 0.08
83 0.09
84 0.09
85 0.12
86 0.12
87 0.12
88 0.19
89 0.2
90 0.22
91 0.22