Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4CB50

Protein Details
Accession A0A2T4CB50    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
62-90SETPDTEHARPRKRTRRACDKCSASRTRCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MEQQRPVIRSPALRLVPAGFAIKGPPAVSPVPVEPQRIMAAEADGQERHRPEPLVAPLAQRSETPDTEHARPRKRTRRACDKCSASRTRCDGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.28
4 0.26
5 0.23
6 0.14
7 0.12
8 0.12
9 0.12
10 0.11
11 0.1
12 0.09
13 0.11
14 0.11
15 0.12
16 0.13
17 0.13
18 0.18
19 0.2
20 0.21
21 0.18
22 0.2
23 0.2
24 0.18
25 0.18
26 0.12
27 0.11
28 0.1
29 0.1
30 0.1
31 0.09
32 0.09
33 0.11
34 0.12
35 0.12
36 0.12
37 0.12
38 0.12
39 0.17
40 0.19
41 0.2
42 0.2
43 0.21
44 0.21
45 0.22
46 0.21
47 0.16
48 0.18
49 0.19
50 0.19
51 0.21
52 0.25
53 0.29
54 0.33
55 0.41
56 0.44
57 0.49
58 0.57
59 0.64
60 0.69
61 0.75
62 0.81
63 0.84
64 0.87
65 0.88
66 0.87
67 0.87
68 0.85
69 0.83
70 0.82
71 0.82
72 0.75
73 0.74