Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4CF35

Protein Details
Accession A0A2T4CF35    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
232-259EQPPDLREIRKREKEEKKRLKEMREKGIBasic
NLS Segment(s)
PositionSequence
240-259IRKREKEEKKRLKEMREKGI
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007715  Coq4  
IPR027540  Coq4_euk  
Gene Ontology GO:0031314  C:extrinsic component of mitochondrial inner membrane  
GO:0006744  P:ubiquinone biosynthetic process  
Pfam View protein in Pfam  
PF05019  Coq4  
Amino Acid Sequences MARRFSALNRPPPKYPGHVPLTRVEQVGMALGSGIMSLLNPYRADLIATLGETTATPYFIYRLRDAMLAHPTGRRILRQRPRISSKTMSLPALRALPPNSVGRAYASWLDREGVSPDTRSPVRYIDDEECAYVMQRYRECHDFYHALTGLPTVREGEVALKAFEFANTLLPMTGLSMLAVATLKPAERRRFFSVYMPWAVKNGVRSQDIINVYWEEQLERDVDDLRRELGIEQPPDLREIRKREKEEKKRLKEMREKGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.57
3 0.55
4 0.55
5 0.54
6 0.53
7 0.55
8 0.57
9 0.52
10 0.46
11 0.37
12 0.29
13 0.25
14 0.24
15 0.18
16 0.1
17 0.07
18 0.07
19 0.06
20 0.05
21 0.05
22 0.03
23 0.03
24 0.04
25 0.06
26 0.08
27 0.08
28 0.09
29 0.11
30 0.11
31 0.12
32 0.11
33 0.12
34 0.11
35 0.11
36 0.11
37 0.09
38 0.09
39 0.08
40 0.1
41 0.08
42 0.08
43 0.08
44 0.08
45 0.1
46 0.13
47 0.17
48 0.16
49 0.17
50 0.18
51 0.2
52 0.2
53 0.23
54 0.23
55 0.21
56 0.21
57 0.21
58 0.21
59 0.23
60 0.23
61 0.24
62 0.27
63 0.36
64 0.44
65 0.53
66 0.59
67 0.64
68 0.71
69 0.69
70 0.69
71 0.64
72 0.58
73 0.55
74 0.51
75 0.44
76 0.36
77 0.33
78 0.29
79 0.27
80 0.24
81 0.19
82 0.18
83 0.17
84 0.18
85 0.19
86 0.18
87 0.15
88 0.15
89 0.14
90 0.13
91 0.13
92 0.14
93 0.14
94 0.13
95 0.13
96 0.14
97 0.12
98 0.12
99 0.13
100 0.11
101 0.11
102 0.11
103 0.11
104 0.14
105 0.15
106 0.15
107 0.14
108 0.14
109 0.16
110 0.16
111 0.19
112 0.17
113 0.19
114 0.18
115 0.17
116 0.15
117 0.13
118 0.12
119 0.1
120 0.09
121 0.09
122 0.11
123 0.13
124 0.16
125 0.2
126 0.21
127 0.21
128 0.24
129 0.23
130 0.21
131 0.25
132 0.23
133 0.19
134 0.17
135 0.17
136 0.14
137 0.12
138 0.12
139 0.07
140 0.06
141 0.06
142 0.07
143 0.08
144 0.09
145 0.09
146 0.09
147 0.08
148 0.09
149 0.09
150 0.09
151 0.08
152 0.06
153 0.08
154 0.08
155 0.08
156 0.08
157 0.08
158 0.08
159 0.07
160 0.07
161 0.05
162 0.04
163 0.04
164 0.04
165 0.05
166 0.05
167 0.04
168 0.04
169 0.05
170 0.06
171 0.12
172 0.19
173 0.28
174 0.32
175 0.38
176 0.44
177 0.48
178 0.49
179 0.49
180 0.49
181 0.45
182 0.46
183 0.42
184 0.35
185 0.32
186 0.32
187 0.27
188 0.23
189 0.24
190 0.24
191 0.23
192 0.25
193 0.25
194 0.31
195 0.32
196 0.29
197 0.26
198 0.23
199 0.22
200 0.22
201 0.21
202 0.15
203 0.13
204 0.13
205 0.12
206 0.1
207 0.11
208 0.13
209 0.15
210 0.17
211 0.18
212 0.18
213 0.17
214 0.17
215 0.17
216 0.2
217 0.25
218 0.24
219 0.25
220 0.27
221 0.28
222 0.3
223 0.31
224 0.29
225 0.3
226 0.38
227 0.47
228 0.54
229 0.61
230 0.69
231 0.78
232 0.85
233 0.88
234 0.9
235 0.89
236 0.9
237 0.9
238 0.9
239 0.89