Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4BTB2

Protein Details
Accession A0A2T4BTB2   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
35-69TINDLKETKKEKQKNKKKKTKKKHTTAGVRQWSPTHydrophilic
NLS Segment(s)
PositionSequence
42-58TKKEKQKNKKKKTKKKH
Subcellular Location(s) nucl 21.5, cyto_nucl 13, mito 4
Family & Domain DBs
Amino Acid Sequences MTSPSPYTVSGISSPHHTTINNHLPTQSQTEGTSTINDLKETKKEKQKNKKKKTKKKHTTAGVRQWSPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.22
4 0.2
5 0.21
6 0.29
7 0.38
8 0.35
9 0.33
10 0.32
11 0.32
12 0.33
13 0.35
14 0.26
15 0.18
16 0.16
17 0.16
18 0.17
19 0.16
20 0.15
21 0.11
22 0.13
23 0.12
24 0.12
25 0.13
26 0.13
27 0.2
28 0.24
29 0.31
30 0.38
31 0.46
32 0.56
33 0.67
34 0.76
35 0.81
36 0.87
37 0.91
38 0.92
39 0.95
40 0.96
41 0.96
42 0.96
43 0.96
44 0.95
45 0.94
46 0.94
47 0.93
48 0.92
49 0.91