Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4C8I3

Protein Details
Accession A0A2T4C8I3   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
104-131KGVSWPISGLKRRRKKKKKNKGREGDQWBasic
NLS Segment(s)
PositionSequence
113-126LKRRRKKKKKNKGR
Subcellular Location(s) nucl 19, cyto 4, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSGRASSGDSPPSEEKGSNNNMDKSLRDAAVVPQSDGEGFVNSYEQEDFWTRNGLNAKSFQKKHYGHGLVELDRAMKTRHLQMIAIGGSIGAGFFVGSGGALAKGVSWPISGLKRRRKKKKKNKGREGDQW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.31
4 0.36
5 0.38
6 0.4
7 0.39
8 0.4
9 0.4
10 0.38
11 0.36
12 0.34
13 0.27
14 0.22
15 0.21
16 0.22
17 0.27
18 0.27
19 0.22
20 0.18
21 0.18
22 0.17
23 0.17
24 0.14
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.08
31 0.07
32 0.07
33 0.08
34 0.1
35 0.11
36 0.11
37 0.14
38 0.13
39 0.16
40 0.2
41 0.19
42 0.19
43 0.24
44 0.28
45 0.33
46 0.35
47 0.33
48 0.39
49 0.39
50 0.41
51 0.44
52 0.42
53 0.34
54 0.37
55 0.38
56 0.29
57 0.28
58 0.25
59 0.16
60 0.14
61 0.14
62 0.1
63 0.1
64 0.11
65 0.15
66 0.18
67 0.18
68 0.18
69 0.18
70 0.21
71 0.19
72 0.17
73 0.12
74 0.09
75 0.08
76 0.07
77 0.07
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.05
93 0.05
94 0.05
95 0.06
96 0.11
97 0.18
98 0.26
99 0.35
100 0.46
101 0.56
102 0.67
103 0.77
104 0.84
105 0.89
106 0.92
107 0.95
108 0.95
109 0.97
110 0.97
111 0.97