Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4C834

Protein Details
Accession A0A2T4C834    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-21HSGRNKKGRGHTKPIRCSNCSHydrophilic
75-105GKIVRVRSREGRRNRAPPPRVRYNKDGKKIVBasic
NLS Segment(s)
PositionSequence
79-104RVRSREGRRNRAPPPRVRYNKDGKKI
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences HSGRNKKGRGHTKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFAEYTVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRVRYNKDGKKIVPTAAPKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.85
3 0.78
4 0.79
5 0.77
6 0.77
7 0.75
8 0.72
9 0.7
10 0.7
11 0.72
12 0.72
13 0.73
14 0.72
15 0.73
16 0.74
17 0.76
18 0.72
19 0.73
20 0.69
21 0.69
22 0.61
23 0.53
24 0.47
25 0.38
26 0.35
27 0.28
28 0.25
29 0.16
30 0.15
31 0.12
32 0.1
33 0.1
34 0.08
35 0.08
36 0.06
37 0.05
38 0.05
39 0.05
40 0.05
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.07
47 0.08
48 0.1
49 0.16
50 0.18
51 0.2
52 0.23
53 0.23
54 0.24
55 0.27
56 0.24
57 0.19
58 0.19
59 0.18
60 0.19
61 0.19
62 0.21
63 0.22
64 0.28
65 0.31
66 0.32
67 0.35
68 0.4
69 0.49
70 0.55
71 0.62
72 0.65
73 0.69
74 0.76
75 0.8
76 0.81
77 0.8
78 0.8
79 0.79
80 0.8
81 0.81
82 0.79
83 0.79
84 0.79
85 0.81
86 0.8
87 0.79
88 0.7
89 0.71
90 0.67
91 0.62
92 0.59