Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4CCY2

Protein Details
Accession A0A2T4CCY2    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-30GGASTQLRPRRREKKASARCHASSHydrophilic
108-137PQQEYFRKWCKPKSQRKKRLRALQLQCCSAHydrophilic
NLS Segment(s)
PositionSequence
15-21PRRREKK
120-126KSQRKKR
Subcellular Location(s) nucl 11.5, mito 9, cyto_nucl 7, plas 3, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MSTCSKGGASTQLRPRRREKKASARCHASSSTDGSAMLVLDSTSCKFSLYTSTSLCDYVFSCAILYECSIRLRRGIVIILYTPVVRLLRCIEPCRSLVTSHQIPMIPPQQEYFRKWCKPKSQRKKRLRALQLQCCSAYIPPMSQSTMLPVYRHQLLFYMYTSHVITKRIASNETASPPISMYICTLKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.71
3 0.72
4 0.76
5 0.79
6 0.79
7 0.81
8 0.85
9 0.9
10 0.89
11 0.86
12 0.79
13 0.73
14 0.65
15 0.57
16 0.49
17 0.44
18 0.36
19 0.28
20 0.25
21 0.2
22 0.19
23 0.14
24 0.11
25 0.07
26 0.05
27 0.05
28 0.06
29 0.07
30 0.08
31 0.08
32 0.08
33 0.08
34 0.09
35 0.16
36 0.18
37 0.21
38 0.21
39 0.23
40 0.23
41 0.23
42 0.23
43 0.17
44 0.13
45 0.13
46 0.12
47 0.1
48 0.09
49 0.09
50 0.09
51 0.09
52 0.09
53 0.07
54 0.08
55 0.12
56 0.13
57 0.14
58 0.14
59 0.15
60 0.15
61 0.15
62 0.15
63 0.12
64 0.11
65 0.11
66 0.1
67 0.09
68 0.08
69 0.07
70 0.08
71 0.08
72 0.06
73 0.07
74 0.1
75 0.14
76 0.17
77 0.19
78 0.2
79 0.22
80 0.22
81 0.25
82 0.22
83 0.18
84 0.18
85 0.22
86 0.21
87 0.2
88 0.21
89 0.18
90 0.17
91 0.21
92 0.24
93 0.18
94 0.17
95 0.17
96 0.22
97 0.25
98 0.28
99 0.32
100 0.35
101 0.42
102 0.47
103 0.53
104 0.58
105 0.65
106 0.73
107 0.77
108 0.81
109 0.85
110 0.9
111 0.94
112 0.93
113 0.93
114 0.9
115 0.89
116 0.87
117 0.87
118 0.8
119 0.72
120 0.62
121 0.52
122 0.44
123 0.33
124 0.26
125 0.17
126 0.13
127 0.13
128 0.15
129 0.15
130 0.15
131 0.15
132 0.16
133 0.2
134 0.2
135 0.19
136 0.19
137 0.22
138 0.25
139 0.25
140 0.21
141 0.18
142 0.19
143 0.21
144 0.2
145 0.2
146 0.16
147 0.18
148 0.19
149 0.21
150 0.21
151 0.21
152 0.22
153 0.23
154 0.29
155 0.29
156 0.3
157 0.29
158 0.31
159 0.34
160 0.36
161 0.33
162 0.28
163 0.25
164 0.24
165 0.24
166 0.2
167 0.16
168 0.16