Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4CHX8

Protein Details
Accession A0A2T4CHX8    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-48GRNSICGEKKRRKATQRKATQRLATHydrophilic
NLS Segment(s)
PositionSequence
32-38KKRRKAT
Subcellular Location(s) nucl 8, mito 7, extr 7, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MLFFSPLAAYILRLPTLLFSFQAGRNSICGEKKRRKATQRKATQRLATGQPRITSTSTRPALPPEPAYYCPPAAVAYLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.14
5 0.11
6 0.11
7 0.14
8 0.16
9 0.2
10 0.19
11 0.18
12 0.18
13 0.2
14 0.22
15 0.24
16 0.28
17 0.34
18 0.41
19 0.5
20 0.58
21 0.64
22 0.71
23 0.77
24 0.81
25 0.83
26 0.84
27 0.86
28 0.84
29 0.82
30 0.75
31 0.66
32 0.6
33 0.56
34 0.51
35 0.45
36 0.4
37 0.35
38 0.34
39 0.34
40 0.31
41 0.27
42 0.24
43 0.3
44 0.29
45 0.29
46 0.29
47 0.31
48 0.33
49 0.34
50 0.34
51 0.29
52 0.32
53 0.34
54 0.37
55 0.36
56 0.33
57 0.29
58 0.26
59 0.23