Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4BY59

Protein Details
Accession A0A2T4BY59    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-77QHRRLHIKPSKGKRAARREKKTKMKLDEPSDBasic
NLS Segment(s)
PositionSequence
49-71RRLHIKPSKGKRAARREKKTKMK
Subcellular Location(s) mito 19.5, cyto_mito 12.833, cyto 5, cyto_nucl 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF08228  RNase_P_pop3  
Amino Acid Sequences MAAPSAKKRLVHHLDTPFSTSSWPVISLDDQDAILELLCHLLSPIGQHRRLHIKPSKGKRAARREKKTKMKLDEPSDSIKIEPPPVPELSASVDIGFNSITNNLGSLAQPSDSTARPGKGYSMVFVARGSQSPAFNHHFPQMVAAASRNLPDKEKIRLVGFSKPCSERLGSALGIPRVSSVAVSPHAPGADALFALVQSTVSPVESPWLDEAACATYKPTVIGSVETTVGTKRVKAEKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.58
3 0.58
4 0.48
5 0.41
6 0.36
7 0.28
8 0.21
9 0.17
10 0.17
11 0.13
12 0.15
13 0.16
14 0.17
15 0.18
16 0.17
17 0.15
18 0.14
19 0.14
20 0.11
21 0.1
22 0.07
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.08
31 0.17
32 0.24
33 0.29
34 0.3
35 0.35
36 0.44
37 0.46
38 0.52
39 0.51
40 0.54
41 0.59
42 0.69
43 0.75
44 0.73
45 0.79
46 0.79
47 0.84
48 0.85
49 0.86
50 0.86
51 0.86
52 0.88
53 0.91
54 0.91
55 0.89
56 0.86
57 0.83
58 0.81
59 0.77
60 0.72
61 0.64
62 0.59
63 0.51
64 0.44
65 0.35
66 0.3
67 0.25
68 0.22
69 0.21
70 0.19
71 0.21
72 0.21
73 0.21
74 0.17
75 0.17
76 0.17
77 0.16
78 0.14
79 0.11
80 0.11
81 0.1
82 0.1
83 0.09
84 0.06
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.06
92 0.06
93 0.07
94 0.07
95 0.06
96 0.06
97 0.07
98 0.09
99 0.09
100 0.12
101 0.13
102 0.13
103 0.13
104 0.14
105 0.14
106 0.15
107 0.15
108 0.13
109 0.13
110 0.13
111 0.13
112 0.12
113 0.13
114 0.09
115 0.09
116 0.11
117 0.1
118 0.11
119 0.12
120 0.17
121 0.2
122 0.2
123 0.22
124 0.21
125 0.21
126 0.2
127 0.2
128 0.16
129 0.12
130 0.12
131 0.11
132 0.1
133 0.09
134 0.1
135 0.12
136 0.12
137 0.13
138 0.17
139 0.2
140 0.24
141 0.26
142 0.27
143 0.26
144 0.3
145 0.3
146 0.35
147 0.35
148 0.33
149 0.35
150 0.35
151 0.35
152 0.33
153 0.32
154 0.24
155 0.23
156 0.23
157 0.18
158 0.19
159 0.22
160 0.2
161 0.19
162 0.17
163 0.15
164 0.13
165 0.12
166 0.1
167 0.07
168 0.09
169 0.1
170 0.11
171 0.11
172 0.12
173 0.12
174 0.12
175 0.11
176 0.1
177 0.09
178 0.08
179 0.07
180 0.06
181 0.06
182 0.06
183 0.06
184 0.04
185 0.04
186 0.05
187 0.06
188 0.06
189 0.07
190 0.06
191 0.1
192 0.11
193 0.12
194 0.13
195 0.13
196 0.13
197 0.13
198 0.14
199 0.13
200 0.13
201 0.12
202 0.11
203 0.12
204 0.12
205 0.14
206 0.13
207 0.13
208 0.13
209 0.16
210 0.17
211 0.17
212 0.18
213 0.17
214 0.17
215 0.15
216 0.19
217 0.18
218 0.17
219 0.23