Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4BPV1

Protein Details
Accession A0A2T4BPV1    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
307-333GSPALIGKKKPPPPPPKKKPSLSASPAHydrophilic
NLS Segment(s)
PositionSequence
18-36KASGLKGKAKGKVTKHIPG
313-327GKKKPPPPPPKKKPS
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSKYAEMAKGKLSSASEKASGLKGKAKGKVTKHIPGRGNKDDSDAGQAHVAPPLSSLRDPNSFAPPPRRTGSGFAPPPPPTTAKRSVVPAPSKYQDPHAPKVESPPPRFADESQLQSYEDEQEAQAASSPRPYRVDTTGLSTQHLPPPPIRRDRDAAGSRSPPSYDSVVGASPSDAKAPRLPPRLPPRSGSGTPDQTASPLSTLGVSSGSLNQGAVQRLGAAGISVPAFGIGSSSPSHTGTADEAAPPKPPRPNATPPSQLNELQNRFARLGTSAAPASESAAANTAATWAQKQATTMAAAPPSPSGSPALIGKKKPPPPPPKKKPSLSASPAAAAPGQGPAPPPIPMSTRPSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.29
4 0.28
5 0.3
6 0.32
7 0.34
8 0.32
9 0.35
10 0.38
11 0.43
12 0.49
13 0.54
14 0.56
15 0.58
16 0.65
17 0.66
18 0.68
19 0.7
20 0.71
21 0.71
22 0.72
23 0.75
24 0.73
25 0.71
26 0.62
27 0.59
28 0.52
29 0.46
30 0.44
31 0.36
32 0.28
33 0.24
34 0.24
35 0.19
36 0.2
37 0.19
38 0.12
39 0.12
40 0.14
41 0.16
42 0.17
43 0.19
44 0.21
45 0.25
46 0.28
47 0.29
48 0.35
49 0.35
50 0.39
51 0.46
52 0.45
53 0.47
54 0.47
55 0.47
56 0.41
57 0.42
58 0.44
59 0.44
60 0.44
61 0.42
62 0.46
63 0.44
64 0.44
65 0.42
66 0.4
67 0.33
68 0.37
69 0.42
70 0.39
71 0.41
72 0.43
73 0.45
74 0.5
75 0.52
76 0.48
77 0.46
78 0.45
79 0.46
80 0.42
81 0.42
82 0.42
83 0.43
84 0.46
85 0.46
86 0.46
87 0.43
88 0.49
89 0.52
90 0.52
91 0.49
92 0.49
93 0.45
94 0.46
95 0.48
96 0.41
97 0.42
98 0.37
99 0.39
100 0.33
101 0.32
102 0.29
103 0.27
104 0.27
105 0.21
106 0.16
107 0.12
108 0.1
109 0.1
110 0.09
111 0.09
112 0.11
113 0.1
114 0.1
115 0.15
116 0.17
117 0.18
118 0.21
119 0.22
120 0.23
121 0.24
122 0.28
123 0.23
124 0.27
125 0.3
126 0.28
127 0.27
128 0.26
129 0.25
130 0.26
131 0.27
132 0.22
133 0.21
134 0.29
135 0.35
136 0.41
137 0.42
138 0.41
139 0.43
140 0.44
141 0.49
142 0.45
143 0.42
144 0.37
145 0.37
146 0.35
147 0.32
148 0.3
149 0.22
150 0.19
151 0.18
152 0.14
153 0.12
154 0.12
155 0.11
156 0.11
157 0.1
158 0.08
159 0.07
160 0.07
161 0.08
162 0.08
163 0.09
164 0.12
165 0.16
166 0.23
167 0.29
168 0.3
169 0.36
170 0.46
171 0.52
172 0.5
173 0.48
174 0.46
175 0.46
176 0.47
177 0.42
178 0.37
179 0.34
180 0.32
181 0.31
182 0.26
183 0.2
184 0.19
185 0.15
186 0.1
187 0.07
188 0.07
189 0.06
190 0.06
191 0.06
192 0.05
193 0.05
194 0.05
195 0.06
196 0.06
197 0.06
198 0.06
199 0.08
200 0.1
201 0.11
202 0.1
203 0.09
204 0.09
205 0.09
206 0.09
207 0.07
208 0.04
209 0.03
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.03
217 0.04
218 0.03
219 0.05
220 0.06
221 0.07
222 0.09
223 0.1
224 0.11
225 0.1
226 0.11
227 0.11
228 0.12
229 0.11
230 0.11
231 0.13
232 0.13
233 0.18
234 0.18
235 0.21
236 0.25
237 0.28
238 0.33
239 0.38
240 0.48
241 0.48
242 0.54
243 0.59
244 0.55
245 0.58
246 0.55
247 0.5
248 0.46
249 0.5
250 0.45
251 0.42
252 0.43
253 0.39
254 0.36
255 0.33
256 0.28
257 0.2
258 0.2
259 0.16
260 0.17
261 0.15
262 0.14
263 0.14
264 0.13
265 0.14
266 0.15
267 0.13
268 0.1
269 0.12
270 0.12
271 0.11
272 0.11
273 0.1
274 0.08
275 0.09
276 0.09
277 0.1
278 0.11
279 0.12
280 0.13
281 0.13
282 0.14
283 0.15
284 0.16
285 0.17
286 0.17
287 0.16
288 0.16
289 0.16
290 0.17
291 0.15
292 0.15
293 0.14
294 0.13
295 0.14
296 0.19
297 0.27
298 0.31
299 0.34
300 0.4
301 0.48
302 0.55
303 0.62
304 0.67
305 0.69
306 0.75
307 0.84
308 0.87
309 0.89
310 0.91
311 0.9
312 0.89
313 0.86
314 0.85
315 0.8
316 0.76
317 0.67
318 0.59
319 0.52
320 0.44
321 0.35
322 0.25
323 0.19
324 0.15
325 0.13
326 0.11
327 0.13
328 0.15
329 0.16
330 0.17
331 0.19
332 0.19
333 0.23
334 0.27