Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4CAQ9

Protein Details
Accession A0A2T4CAQ9    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
88-126GHTRLVQKRRHGWLKRTRSKTGRRILQRRKLKGRRHVAWBasic
NLS Segment(s)
PositionSequence
95-123KRRHGWLKRTRSKTGRRILQRRKLKGRRH
Subcellular Location(s) mito 17, nucl 7, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MNSIIRLARPLLPRIAPLSQRTYTCLSPLRPTLTSTFRPTATSFTPSPTTTATSSEASADVVPAAAVSAHPALQGMQLRFGPRNTMNGHTRLVQKRRHGWLKRTRSKTGRRILQRRKLKGRRHVAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.35
4 0.35
5 0.38
6 0.37
7 0.37
8 0.38
9 0.38
10 0.33
11 0.33
12 0.34
13 0.3
14 0.32
15 0.35
16 0.35
17 0.32
18 0.34
19 0.34
20 0.34
21 0.36
22 0.37
23 0.35
24 0.32
25 0.33
26 0.32
27 0.31
28 0.27
29 0.28
30 0.22
31 0.23
32 0.25
33 0.23
34 0.24
35 0.21
36 0.21
37 0.17
38 0.19
39 0.18
40 0.16
41 0.16
42 0.15
43 0.13
44 0.11
45 0.1
46 0.08
47 0.05
48 0.04
49 0.04
50 0.03
51 0.03
52 0.02
53 0.02
54 0.03
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.07
61 0.11
62 0.1
63 0.12
64 0.13
65 0.15
66 0.17
67 0.17
68 0.19
69 0.17
70 0.22
71 0.23
72 0.27
73 0.29
74 0.3
75 0.32
76 0.3
77 0.38
78 0.41
79 0.46
80 0.47
81 0.51
82 0.57
83 0.65
84 0.72
85 0.71
86 0.72
87 0.76
88 0.81
89 0.83
90 0.82
91 0.82
92 0.81
93 0.84
94 0.84
95 0.83
96 0.82
97 0.83
98 0.87
99 0.88
100 0.89
101 0.89
102 0.9
103 0.91
104 0.91
105 0.9
106 0.89