Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4BZX4

Protein Details
Accession A0A2T4BZX4   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-29QLAAPRLDRSRSRRKRNIPSTHPRSGAHydrophilic
NLS Segment(s)
PositionSequence
12-19SRSRRKRN
Subcellular Location(s) plas 12, mito 9, nucl 1, cyto 1, extr 1, cyto_nucl 1, pero 1, E.R. 1, vacu 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTQLAAPRLDRSRSRRKRNIPSTHPRSGAVRNAKLGDFLLGKLLRRNRMISFATYAFFCVIIGFLLSPFHCMEGIEPVAFSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.75
3 0.81
4 0.87
5 0.89
6 0.92
7 0.9
8 0.91
9 0.88
10 0.85
11 0.76
12 0.66
13 0.59
14 0.53
15 0.51
16 0.47
17 0.41
18 0.37
19 0.36
20 0.35
21 0.32
22 0.27
23 0.21
24 0.13
25 0.11
26 0.13
27 0.12
28 0.12
29 0.16
30 0.19
31 0.22
32 0.23
33 0.26
34 0.22
35 0.28
36 0.29
37 0.27
38 0.27
39 0.24
40 0.22
41 0.2
42 0.2
43 0.14
44 0.12
45 0.1
46 0.06
47 0.06
48 0.05
49 0.05
50 0.05
51 0.05
52 0.07
53 0.07
54 0.09
55 0.09
56 0.1
57 0.1
58 0.1
59 0.11
60 0.15
61 0.17
62 0.15