Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4BYC6

Protein Details
Accession A0A2T4BYC6    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
52-74GSEATRPAKRGRRSNPKVKTGCLHydrophilic
NLS Segment(s)
PositionSequence
59-65AKRGRRS
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MASPGHRPAIMASIEGSYQTPAATPTGSPDPDGMEPLLPPTSMASAIGGDSGSEATRPAKRGRRSNPKVKTGCLNCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.09
5 0.08
6 0.08
7 0.07
8 0.07
9 0.08
10 0.08
11 0.07
12 0.1
13 0.14
14 0.15
15 0.15
16 0.14
17 0.16
18 0.16
19 0.17
20 0.13
21 0.09
22 0.09
23 0.09
24 0.09
25 0.07
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.08
43 0.12
44 0.15
45 0.23
46 0.31
47 0.4
48 0.5
49 0.6
50 0.68
51 0.75
52 0.82
53 0.84
54 0.86
55 0.82
56 0.76
57 0.76