Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4CA35

Protein Details
Accession A0A2T4CA35   
Localization Confidence High
Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MGMPNKKRRNDNKSHRPNKKQRRAQAYNSDSEHydrophilic
77-99EAPVEKKKKATSKKSRSTKSESEHydrophilic
NLS Segment(s)
PositionSequence
6-23KKRRNDNKSHRPNKKQRR
82-92KKKKATSKKSR
194-206KARRKLKEQKRVA
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012459  Rrp15  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF07890  Rrp15p  
Amino Acid Sequences MGMPNKKRRNDNKSHRPNKKQRRAQAYNSDSEPEEEQQQQQAFDPVNLLDSDDDIHNAPADDGAGADEDASSSSDEEAPVEKKKKATSKKSRSTKSESEPEAAQQEDDNDEEAGEDEQEGESDDDEDDEDEFDLGVDAPKKKSKRNDPTAFATSLSKILNTKLSASKRSDPVLSRSAAAHEASKAAVDIALEAKARRKLKEQKRVALEKGRVKDVLVASVDESGEPEMTTSEILAIEKTLRKTAQRGVIRMFNAVRAAQVQAAEAEKAARKEGIIGAKSREEKVNEMSKKGFLDLIASGGGGLKKTPLEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.95
4 0.95
5 0.96
6 0.95
7 0.94
8 0.93
9 0.93
10 0.9
11 0.89
12 0.88
13 0.83
14 0.78
15 0.7
16 0.62
17 0.52
18 0.46
19 0.39
20 0.3
21 0.28
22 0.25
23 0.24
24 0.27
25 0.28
26 0.26
27 0.25
28 0.27
29 0.23
30 0.21
31 0.2
32 0.15
33 0.15
34 0.14
35 0.13
36 0.1
37 0.09
38 0.11
39 0.09
40 0.11
41 0.1
42 0.1
43 0.1
44 0.1
45 0.09
46 0.08
47 0.08
48 0.06
49 0.05
50 0.06
51 0.06
52 0.05
53 0.05
54 0.05
55 0.04
56 0.05
57 0.06
58 0.06
59 0.06
60 0.07
61 0.08
62 0.08
63 0.08
64 0.11
65 0.13
66 0.2
67 0.24
68 0.25
69 0.28
70 0.35
71 0.44
72 0.51
73 0.6
74 0.64
75 0.71
76 0.79
77 0.86
78 0.87
79 0.85
80 0.83
81 0.8
82 0.76
83 0.74
84 0.66
85 0.58
86 0.51
87 0.45
88 0.39
89 0.31
90 0.24
91 0.15
92 0.13
93 0.12
94 0.11
95 0.1
96 0.08
97 0.08
98 0.07
99 0.08
100 0.07
101 0.06
102 0.05
103 0.04
104 0.04
105 0.04
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.05
115 0.05
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.05
123 0.07
124 0.09
125 0.11
126 0.17
127 0.19
128 0.25
129 0.34
130 0.44
131 0.52
132 0.61
133 0.66
134 0.66
135 0.7
136 0.67
137 0.59
138 0.49
139 0.39
140 0.29
141 0.24
142 0.19
143 0.13
144 0.1
145 0.1
146 0.12
147 0.12
148 0.14
149 0.18
150 0.21
151 0.25
152 0.29
153 0.32
154 0.32
155 0.33
156 0.34
157 0.29
158 0.31
159 0.31
160 0.27
161 0.23
162 0.21
163 0.2
164 0.19
165 0.17
166 0.13
167 0.1
168 0.1
169 0.09
170 0.09
171 0.07
172 0.06
173 0.05
174 0.04
175 0.05
176 0.05
177 0.06
178 0.07
179 0.07
180 0.11
181 0.18
182 0.2
183 0.22
184 0.3
185 0.4
186 0.5
187 0.6
188 0.64
189 0.66
190 0.72
191 0.75
192 0.72
193 0.7
194 0.66
195 0.63
196 0.58
197 0.53
198 0.44
199 0.39
200 0.39
201 0.31
202 0.27
203 0.21
204 0.18
205 0.16
206 0.16
207 0.16
208 0.11
209 0.11
210 0.07
211 0.07
212 0.06
213 0.06
214 0.05
215 0.06
216 0.06
217 0.05
218 0.05
219 0.06
220 0.06
221 0.06
222 0.06
223 0.09
224 0.13
225 0.15
226 0.18
227 0.19
228 0.22
229 0.26
230 0.32
231 0.38
232 0.4
233 0.43
234 0.43
235 0.47
236 0.45
237 0.46
238 0.39
239 0.32
240 0.28
241 0.25
242 0.21
243 0.16
244 0.17
245 0.14
246 0.14
247 0.12
248 0.11
249 0.12
250 0.12
251 0.11
252 0.12
253 0.14
254 0.15
255 0.16
256 0.15
257 0.14
258 0.16
259 0.21
260 0.26
261 0.26
262 0.28
263 0.3
264 0.36
265 0.39
266 0.39
267 0.4
268 0.35
269 0.36
270 0.41
271 0.47
272 0.44
273 0.46
274 0.45
275 0.43
276 0.42
277 0.39
278 0.33
279 0.23
280 0.22
281 0.18
282 0.18
283 0.14
284 0.12
285 0.11
286 0.12
287 0.13
288 0.1
289 0.1
290 0.1
291 0.11