Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4BTF8

Protein Details
Accession A0A2T4BTF8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGKRKSSSRKPMGPKRADPLBasic
NLS Segment(s)
PositionSequence
4-14RKSSSRKPMGP
Subcellular Location(s) mito 19, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSSRKPMGPKRADPLPTTFTCLFCNHEKAVTVKLDKRAGVGQLDCRICGQKFQCAVNYLSAAVDVYGEWVDAAEAVAKQDAGEGNTAKSFGARRPLEKNTVDEHEENDLHDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.76
4 0.7
5 0.62
6 0.57
7 0.52
8 0.44
9 0.45
10 0.4
11 0.34
12 0.33
13 0.32
14 0.3
15 0.27
16 0.31
17 0.25
18 0.25
19 0.25
20 0.24
21 0.26
22 0.27
23 0.27
24 0.27
25 0.32
26 0.33
27 0.31
28 0.32
29 0.29
30 0.26
31 0.25
32 0.22
33 0.2
34 0.23
35 0.23
36 0.21
37 0.2
38 0.21
39 0.19
40 0.22
41 0.2
42 0.19
43 0.21
44 0.22
45 0.24
46 0.23
47 0.24
48 0.21
49 0.2
50 0.14
51 0.12
52 0.11
53 0.08
54 0.06
55 0.05
56 0.03
57 0.04
58 0.04
59 0.04
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.04
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.06
72 0.07
73 0.07
74 0.09
75 0.1
76 0.11
77 0.11
78 0.12
79 0.1
80 0.11
81 0.13
82 0.13
83 0.23
84 0.25
85 0.29
86 0.36
87 0.41
88 0.47
89 0.48
90 0.49
91 0.44
92 0.46
93 0.47
94 0.41
95 0.38
96 0.37
97 0.34
98 0.31