Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4CEK5

Protein Details
Accession A0A2T4CEK5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
225-253QLPCYCQTRRSTGRRLRRRLNAKRHSCSGHydrophilic
NLS Segment(s)
PositionSequence
238-245RRLRRRLN
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MMGLGTHGRTGGHTGGRTDGRMGSTHGWATGAAIPKPNLNPASSACVKDPKVHRPASRSHNIGAASPPTSTTSTCVRPRCSSRPGLRDQRIETARRAADPEPMHNRMACACSPPRVSGLLPCGTHSPRHVSWHRIMGSNHRRCETPNVARRCHTRESPMPCRPYQVPLRRLPCSPPTALTTFPVPLVPHWREPTSALPLSVHGGAPVRGASRPASRRGDIEGILQLPCYCQTRRSTGRRLRRRLNAKRHSCSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.29
4 0.29
5 0.27
6 0.25
7 0.22
8 0.22
9 0.25
10 0.22
11 0.23
12 0.22
13 0.21
14 0.19
15 0.17
16 0.18
17 0.18
18 0.19
19 0.17
20 0.21
21 0.21
22 0.24
23 0.26
24 0.3
25 0.27
26 0.24
27 0.25
28 0.24
29 0.31
30 0.3
31 0.31
32 0.27
33 0.32
34 0.33
35 0.38
36 0.42
37 0.43
38 0.49
39 0.54
40 0.56
41 0.54
42 0.61
43 0.62
44 0.63
45 0.57
46 0.5
47 0.47
48 0.43
49 0.4
50 0.34
51 0.28
52 0.2
53 0.17
54 0.17
55 0.15
56 0.16
57 0.15
58 0.15
59 0.18
60 0.24
61 0.31
62 0.35
63 0.37
64 0.43
65 0.5
66 0.54
67 0.55
68 0.57
69 0.58
70 0.6
71 0.65
72 0.69
73 0.67
74 0.66
75 0.62
76 0.62
77 0.58
78 0.53
79 0.46
80 0.42
81 0.37
82 0.32
83 0.33
84 0.24
85 0.27
86 0.26
87 0.3
88 0.31
89 0.32
90 0.32
91 0.29
92 0.29
93 0.24
94 0.25
95 0.19
96 0.16
97 0.15
98 0.18
99 0.19
100 0.2
101 0.2
102 0.19
103 0.19
104 0.17
105 0.2
106 0.19
107 0.18
108 0.18
109 0.19
110 0.19
111 0.2
112 0.18
113 0.2
114 0.18
115 0.25
116 0.27
117 0.28
118 0.3
119 0.36
120 0.36
121 0.34
122 0.34
123 0.37
124 0.46
125 0.48
126 0.48
127 0.42
128 0.41
129 0.38
130 0.46
131 0.44
132 0.43
133 0.44
134 0.48
135 0.49
136 0.52
137 0.55
138 0.53
139 0.49
140 0.42
141 0.4
142 0.42
143 0.48
144 0.55
145 0.57
146 0.56
147 0.51
148 0.53
149 0.48
150 0.47
151 0.48
152 0.47
153 0.48
154 0.51
155 0.57
156 0.55
157 0.55
158 0.53
159 0.49
160 0.44
161 0.38
162 0.32
163 0.31
164 0.3
165 0.3
166 0.26
167 0.23
168 0.19
169 0.18
170 0.17
171 0.14
172 0.14
173 0.21
174 0.23
175 0.26
176 0.3
177 0.3
178 0.3
179 0.32
180 0.35
181 0.34
182 0.31
183 0.26
184 0.23
185 0.23
186 0.24
187 0.22
188 0.18
189 0.11
190 0.12
191 0.11
192 0.12
193 0.12
194 0.11
195 0.11
196 0.12
197 0.15
198 0.23
199 0.27
200 0.34
201 0.39
202 0.39
203 0.4
204 0.44
205 0.44
206 0.36
207 0.35
208 0.31
209 0.26
210 0.24
211 0.23
212 0.18
213 0.15
214 0.17
215 0.18
216 0.16
217 0.2
218 0.25
219 0.34
220 0.44
221 0.52
222 0.6
223 0.66
224 0.76
225 0.82
226 0.86
227 0.87
228 0.88
229 0.9
230 0.9
231 0.91
232 0.91
233 0.91