Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4C0C1

Protein Details
Accession A0A2T4C0C1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-91RFSSRDRRIRRAARRTRDRGRKCRTGRRRATTAGBasic
NLS Segment(s)
PositionSequence
62-87RDRRIRRAARRTRDRGRKCRTGRRRA
Subcellular Location(s) mito 11, plas 6, extr 4, cyto 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASRFLVPSASSAKKYAEKAWKQTPCFDEQRAWLFHFIAFFFLFPLLLYVPLLSLPLRFSSRDRRIRRAARRTRDRGRKCRTGRRRATTAGRESEAATNRYHGGNFFYTVFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.41
4 0.44
5 0.47
6 0.53
7 0.62
8 0.66
9 0.62
10 0.67
11 0.62
12 0.58
13 0.56
14 0.5
15 0.43
16 0.39
17 0.42
18 0.38
19 0.35
20 0.3
21 0.26
22 0.24
23 0.22
24 0.17
25 0.14
26 0.11
27 0.1
28 0.09
29 0.08
30 0.07
31 0.06
32 0.07
33 0.05
34 0.05
35 0.05
36 0.04
37 0.04
38 0.04
39 0.05
40 0.04
41 0.04
42 0.05
43 0.07
44 0.08
45 0.09
46 0.12
47 0.22
48 0.32
49 0.41
50 0.46
51 0.51
52 0.59
53 0.68
54 0.76
55 0.77
56 0.77
57 0.78
58 0.83
59 0.85
60 0.86
61 0.88
62 0.88
63 0.87
64 0.86
65 0.85
66 0.84
67 0.86
68 0.86
69 0.86
70 0.86
71 0.84
72 0.82
73 0.79
74 0.8
75 0.77
76 0.74
77 0.68
78 0.59
79 0.51
80 0.47
81 0.46
82 0.41
83 0.34
84 0.28
85 0.25
86 0.25
87 0.25
88 0.24
89 0.19
90 0.19
91 0.2
92 0.21