Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4CIQ0

Protein Details
Accession A0A2T4CIQ0    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-45GRGGRRGEEEKRRKKEKKDWMQRNQARKLHBasic
NLS Segment(s)
PositionSequence
16-35GRGGRRGEEEKRRKKEKKDW
Subcellular Location(s) nucl 18, cyto_nucl 12.833, cyto 5.5, cyto_pero 3.666
Family & Domain DBs
Amino Acid Sequences MEEQIQESQEGGGSEGRGGRRGEEEKRRKKEKKDWMQRNQARKLHVRVTSREEGRTVGFPGLDAPSTKVSDYLPQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.14
4 0.16
5 0.16
6 0.17
7 0.21
8 0.25
9 0.33
10 0.4
11 0.51
12 0.57
13 0.66
14 0.75
15 0.77
16 0.81
17 0.83
18 0.83
19 0.84
20 0.85
21 0.86
22 0.85
23 0.89
24 0.86
25 0.85
26 0.82
27 0.74
28 0.68
29 0.63
30 0.58
31 0.54
32 0.53
33 0.48
34 0.44
35 0.48
36 0.51
37 0.48
38 0.44
39 0.38
40 0.33
41 0.31
42 0.29
43 0.23
44 0.17
45 0.14
46 0.13
47 0.14
48 0.14
49 0.13
50 0.12
51 0.13
52 0.16
53 0.17
54 0.18
55 0.17
56 0.17