Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4CFX2

Protein Details
Accession A0A2T4CFX2    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
79-104QDTWTEQKAHRRQDARRRPYRADRIYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MPQSTTTRGGPASSQKARPTLSGKTPMSTARHTRHRKILRDTIQGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCTYVEYRNAKTVTVEDVLHSLRRRGRTLYGFDQDTWTEQKAHRRQDARRRPYRADRIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.47
4 0.47
5 0.48
6 0.44
7 0.41
8 0.42
9 0.46
10 0.43
11 0.4
12 0.4
13 0.41
14 0.4
15 0.39
16 0.4
17 0.38
18 0.48
19 0.53
20 0.57
21 0.63
22 0.67
23 0.69
24 0.7
25 0.72
26 0.69
27 0.68
28 0.66
29 0.58
30 0.51
31 0.44
32 0.36
33 0.26
34 0.2
35 0.14
36 0.11
37 0.15
38 0.15
39 0.16
40 0.2
41 0.2
42 0.2
43 0.19
44 0.19
45 0.16
46 0.16
47 0.15
48 0.1
49 0.12
50 0.13
51 0.16
52 0.15
53 0.16
54 0.19
55 0.22
56 0.24
57 0.25
58 0.31
59 0.34
60 0.4
61 0.43
62 0.44
63 0.42
64 0.41
65 0.4
66 0.34
67 0.31
68 0.28
69 0.22
70 0.21
71 0.22
72 0.32
73 0.37
74 0.45
75 0.51
76 0.56
77 0.64
78 0.72
79 0.8
80 0.81
81 0.83
82 0.82
83 0.82
84 0.85