Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3YXH0

Protein Details
Accession A0A2T3YXH0    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
2-25CISTSDKLQKRQKEKTYNSRCSPVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 6, cyto_nucl 5.5, cyto 3
Family & Domain DBs
Amino Acid Sequences FCISTSDKLQKRQKEKTYNSRCSPVVTHLTTNLPLIGLTLGERTGSRIFQWIWSYVTILAARSTYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.85
4 0.87
5 0.87
6 0.82
7 0.77
8 0.67
9 0.59
10 0.51
11 0.45
12 0.41
13 0.33
14 0.29
15 0.26
16 0.27
17 0.24
18 0.22
19 0.17
20 0.1
21 0.08
22 0.08
23 0.06
24 0.04
25 0.04
26 0.04
27 0.04
28 0.05
29 0.05
30 0.08
31 0.09
32 0.1
33 0.1
34 0.14
35 0.14
36 0.18
37 0.21
38 0.2
39 0.21
40 0.21
41 0.21
42 0.18
43 0.21
44 0.17
45 0.15
46 0.14