Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZER1

Protein Details
Accession A0A2T3ZER1    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
42-74RIYRKIKRAFEKQKENERNKKKKKTNLIQVQTWHydrophilic
NLS Segment(s)
PositionSequence
45-65RKIKRAFEKQKENERNKKKKK
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 5, pero 3
Family & Domain DBs
Amino Acid Sequences MLGYGLSHGSRENQFIWFTALDPSIWPYLASSMLRAMTLSERIYRKIKRAFEKQKENERNKKKKKTNLIQVQTWIEHTYTHIPVYLTHFIYTWTGRGMAISIYPWDWVSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.23
4 0.18
5 0.17
6 0.16
7 0.16
8 0.13
9 0.13
10 0.15
11 0.12
12 0.12
13 0.11
14 0.09
15 0.1
16 0.12
17 0.12
18 0.1
19 0.11
20 0.11
21 0.11
22 0.11
23 0.1
24 0.09
25 0.11
26 0.12
27 0.15
28 0.16
29 0.2
30 0.26
31 0.28
32 0.34
33 0.39
34 0.45
35 0.47
36 0.57
37 0.64
38 0.67
39 0.75
40 0.75
41 0.79
42 0.82
43 0.83
44 0.82
45 0.82
46 0.84
47 0.84
48 0.87
49 0.85
50 0.84
51 0.86
52 0.86
53 0.86
54 0.86
55 0.81
56 0.73
57 0.68
58 0.62
59 0.51
60 0.43
61 0.33
62 0.22
63 0.17
64 0.17
65 0.17
66 0.16
67 0.15
68 0.16
69 0.15
70 0.16
71 0.22
72 0.25
73 0.21
74 0.21
75 0.2
76 0.2
77 0.22
78 0.22
79 0.16
80 0.13
81 0.12
82 0.12
83 0.12
84 0.12
85 0.1
86 0.09
87 0.1
88 0.1
89 0.1
90 0.11
91 0.11