Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZGL4

Protein Details
Accession A0A2T3ZGL4   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-50NAHEKKNGNMRKKGKEKKRRREKVSEKKKRVHDMBasic
NLS Segment(s)
PositionSequence
21-46KKNGNMRKKGKEKKRRREKVSEKKKR
Subcellular Location(s) mito 15.5, cyto_mito 10, nucl 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MKTPALISSSTFLAFVNAHEKKNGNMRKKGKEKKRRREKVSEKKKRVHDMLIQDFPTVSPFFYTSYVSSHCRKYPPPSSSFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.19
4 0.2
5 0.21
6 0.23
7 0.24
8 0.25
9 0.35
10 0.42
11 0.41
12 0.47
13 0.55
14 0.62
15 0.72
16 0.8
17 0.81
18 0.84
19 0.87
20 0.88
21 0.92
22 0.92
23 0.89
24 0.9
25 0.91
26 0.91
27 0.91
28 0.91
29 0.87
30 0.85
31 0.84
32 0.8
33 0.72
34 0.66
35 0.6
36 0.58
37 0.58
38 0.54
39 0.47
40 0.4
41 0.36
42 0.31
43 0.27
44 0.18
45 0.12
46 0.09
47 0.09
48 0.11
49 0.12
50 0.14
51 0.13
52 0.16
53 0.19
54 0.22
55 0.26
56 0.29
57 0.32
58 0.36
59 0.41
60 0.47
61 0.53
62 0.56