Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZF56

Protein Details
Accession A0A2T3ZF56   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-86AFPMKMLLQKKKKREDKGEKKKKKNSSPYASYRTLHydrophilic
NLS Segment(s)
PositionSequence
61-76KKKKREDKGEKKKKKN
Subcellular Location(s) mito 13, plas 7, cyto_mito 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSPSSRAHKAAKRPHLRSLVCPISNLQFVTSSFLIKCNPIFVCFALLACLLAFPMKMLLQKKKKREDKGEKKKKKNSSPYASYRTLLPFFSCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.72
4 0.67
5 0.66
6 0.64
7 0.54
8 0.5
9 0.43
10 0.37
11 0.37
12 0.32
13 0.23
14 0.15
15 0.15
16 0.19
17 0.17
18 0.15
19 0.13
20 0.15
21 0.15
22 0.14
23 0.14
24 0.13
25 0.13
26 0.13
27 0.14
28 0.13
29 0.14
30 0.12
31 0.12
32 0.09
33 0.09
34 0.07
35 0.06
36 0.05
37 0.04
38 0.04
39 0.04
40 0.03
41 0.04
42 0.05
43 0.09
44 0.13
45 0.23
46 0.33
47 0.41
48 0.5
49 0.6
50 0.68
51 0.74
52 0.81
53 0.83
54 0.84
55 0.88
56 0.91
57 0.91
58 0.93
59 0.93
60 0.93
61 0.92
62 0.91
63 0.91
64 0.89
65 0.88
66 0.86
67 0.84
68 0.77
69 0.67
70 0.59
71 0.54
72 0.46
73 0.38