Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3ZEY9

Protein Details
Accession A0A2T3ZEY9    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
307-327SKPALKAPPKKANENPPPPRSHydrophilic
NLS Segment(s)
PositionSequence
233-236PRKR
310-339ALKAPPKKANENPPPPRSLPFAKKKAPAKP
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014751  XRCC4-like_C  
Amino Acid Sequences MATTRVIKLPRDDDESAHVLIQVVSKGSKPLDVKLVGTEGEAPYVASLKHDRLSSLQVPNCPVSESEWQSILQSLFALQLVADIQATASVKSETSLSITIRKRVQGITQRLGYIELKHDGDESIELFDWCAESIDALVRSNAALAEAAAHAKELETTVTELKAQLDELVTSKQEDETALLQKFRDLLNEKKVRIREQQKVIAAGSFPNSQPVSQRVSQTSEPQPSRTPAASRPRKRKVQAAASSSKEQHNDEMEVDKIKSEPEDSEPENTPEESADDTASGDSDEDDNGDEDNRSADNSEAGADNVSKPALKAPPKKANENPPPPRSLPFAKKKAPAKPAATGHETDSDDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.43
3 0.37
4 0.32
5 0.27
6 0.2
7 0.19
8 0.19
9 0.14
10 0.13
11 0.13
12 0.13
13 0.16
14 0.16
15 0.21
16 0.21
17 0.23
18 0.29
19 0.3
20 0.3
21 0.29
22 0.3
23 0.24
24 0.23
25 0.23
26 0.16
27 0.15
28 0.14
29 0.11
30 0.1
31 0.11
32 0.1
33 0.11
34 0.14
35 0.16
36 0.2
37 0.2
38 0.21
39 0.23
40 0.3
41 0.33
42 0.38
43 0.39
44 0.38
45 0.41
46 0.41
47 0.39
48 0.33
49 0.27
50 0.23
51 0.28
52 0.29
53 0.28
54 0.27
55 0.27
56 0.26
57 0.29
58 0.24
59 0.16
60 0.11
61 0.1
62 0.09
63 0.09
64 0.08
65 0.05
66 0.06
67 0.06
68 0.06
69 0.05
70 0.04
71 0.04
72 0.06
73 0.07
74 0.07
75 0.07
76 0.08
77 0.08
78 0.08
79 0.09
80 0.07
81 0.09
82 0.12
83 0.12
84 0.2
85 0.22
86 0.27
87 0.29
88 0.31
89 0.31
90 0.3
91 0.36
92 0.38
93 0.43
94 0.44
95 0.43
96 0.41
97 0.39
98 0.4
99 0.34
100 0.26
101 0.21
102 0.18
103 0.17
104 0.17
105 0.17
106 0.14
107 0.13
108 0.12
109 0.1
110 0.08
111 0.08
112 0.08
113 0.07
114 0.07
115 0.07
116 0.06
117 0.06
118 0.04
119 0.04
120 0.05
121 0.07
122 0.07
123 0.07
124 0.07
125 0.06
126 0.07
127 0.07
128 0.06
129 0.04
130 0.04
131 0.03
132 0.04
133 0.05
134 0.05
135 0.05
136 0.05
137 0.04
138 0.04
139 0.05
140 0.04
141 0.04
142 0.04
143 0.06
144 0.07
145 0.07
146 0.07
147 0.08
148 0.08
149 0.08
150 0.07
151 0.06
152 0.06
153 0.06
154 0.07
155 0.07
156 0.07
157 0.07
158 0.07
159 0.07
160 0.07
161 0.07
162 0.07
163 0.08
164 0.13
165 0.13
166 0.14
167 0.13
168 0.14
169 0.15
170 0.13
171 0.16
172 0.16
173 0.2
174 0.29
175 0.35
176 0.35
177 0.39
178 0.41
179 0.41
180 0.46
181 0.49
182 0.48
183 0.49
184 0.54
185 0.51
186 0.5
187 0.45
188 0.37
189 0.29
190 0.22
191 0.18
192 0.13
193 0.11
194 0.14
195 0.14
196 0.13
197 0.15
198 0.17
199 0.2
200 0.21
201 0.24
202 0.22
203 0.26
204 0.28
205 0.32
206 0.35
207 0.38
208 0.37
209 0.36
210 0.37
211 0.34
212 0.36
213 0.32
214 0.29
215 0.29
216 0.39
217 0.47
218 0.54
219 0.62
220 0.67
221 0.75
222 0.75
223 0.76
224 0.74
225 0.74
226 0.72
227 0.69
228 0.66
229 0.62
230 0.62
231 0.56
232 0.51
233 0.42
234 0.36
235 0.32
236 0.28
237 0.25
238 0.23
239 0.22
240 0.2
241 0.2
242 0.19
243 0.16
244 0.13
245 0.12
246 0.12
247 0.11
248 0.12
249 0.14
250 0.2
251 0.21
252 0.25
253 0.27
254 0.28
255 0.28
256 0.26
257 0.22
258 0.17
259 0.16
260 0.14
261 0.13
262 0.11
263 0.09
264 0.1
265 0.09
266 0.09
267 0.08
268 0.06
269 0.06
270 0.07
271 0.06
272 0.06
273 0.07
274 0.07
275 0.08
276 0.09
277 0.08
278 0.08
279 0.09
280 0.09
281 0.08
282 0.09
283 0.09
284 0.09
285 0.09
286 0.1
287 0.1
288 0.1
289 0.11
290 0.1
291 0.11
292 0.11
293 0.11
294 0.1
295 0.1
296 0.16
297 0.22
298 0.31
299 0.4
300 0.49
301 0.59
302 0.64
303 0.72
304 0.75
305 0.78
306 0.8
307 0.81
308 0.81
309 0.77
310 0.78
311 0.71
312 0.66
313 0.62
314 0.61
315 0.6
316 0.61
317 0.64
318 0.66
319 0.72
320 0.76
321 0.79
322 0.79
323 0.77
324 0.72
325 0.72
326 0.71
327 0.69
328 0.66
329 0.58
330 0.52
331 0.5
332 0.46