Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZL18

Protein Details
Accession A0A2T3ZL18    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
79-108RSNSNSAKQKTPQKKKNKPRPVANKSTSNQHydrophilic
NLS Segment(s)
PositionSequence
88-99KTPQKKKNKPRP
Subcellular Location(s) mito_nucl 13.166, nucl 13, mito 13
Family & Domain DBs
Amino Acid Sequences MPRISQSIARVRRASTHQSKRPCGLSGTCRPSGQVPSRPCPRAPHTGRGRSTLWGPDWYLPVDTQALQPRSSASQNETRSNSNSAKQKTPQKKKNKPRPVANKSTSNQHPCPAVPAQHSTAASLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.55
3 0.59
4 0.61
5 0.68
6 0.72
7 0.71
8 0.68
9 0.6
10 0.53
11 0.48
12 0.49
13 0.49
14 0.51
15 0.48
16 0.45
17 0.44
18 0.42
19 0.44
20 0.42
21 0.41
22 0.4
23 0.45
24 0.53
25 0.54
26 0.53
27 0.52
28 0.51
29 0.53
30 0.52
31 0.54
32 0.55
33 0.62
34 0.61
35 0.59
36 0.55
37 0.46
38 0.43
39 0.36
40 0.29
41 0.22
42 0.21
43 0.18
44 0.18
45 0.17
46 0.16
47 0.12
48 0.11
49 0.1
50 0.1
51 0.11
52 0.16
53 0.17
54 0.16
55 0.16
56 0.16
57 0.18
58 0.19
59 0.18
60 0.15
61 0.22
62 0.26
63 0.31
64 0.32
65 0.32
66 0.33
67 0.37
68 0.36
69 0.34
70 0.38
71 0.37
72 0.4
73 0.44
74 0.52
75 0.58
76 0.67
77 0.71
78 0.75
79 0.82
80 0.88
81 0.92
82 0.93
83 0.91
84 0.91
85 0.93
86 0.91
87 0.91
88 0.86
89 0.84
90 0.75
91 0.75
92 0.72
93 0.69
94 0.62
95 0.55
96 0.52
97 0.43
98 0.46
99 0.41
100 0.38
101 0.33
102 0.36
103 0.36
104 0.38
105 0.38