Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3Z343

Protein Details
Accession A0A2T3Z343    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
284-308FTRLPQESKKERAKKAKQAGRSGRMHydrophilic
NLS Segment(s)
PositionSequence
292-305KKERAKKAKQAGRS
331-354RKEGGAGSGVRAMLEKSRKRGAET
357-388GPRGSGHQMGDRFHKKARLLEIGRGSRGKGRK
Subcellular Location(s) nucl 7.5, cyto_nucl 7.5, cyto 6.5, mito 6, extr 3, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MAAPATLPALLASLTQSLSLAQEGTSKIATIEHPKDGISLLDVKNELLLSYLQNLVFLILVKLRNAKSDGKDESKEKGEDLDEVVRSKLVELRLYLEKGARPLEEKLRFSIDRFLRTAEDAQRREKMKEIKDSAKTGSSTDESGSDSEEDDEDEEDDSEAEETGFSKPQTKKGTLSAAPNMGSLIDNVALRPAKRGEDDGAPAGVYRPPRRERQVMETTETREKAARRPMRSHTMEEFVASELSSAPIAEPSIGTTIVQGGRRMKTTQERRDEAERTEYEEANFTRLPQESKKERAKKAKQAGRSGRMQFGGEEWHNLGEGIDRIDRLTKRKEGGAGSGVRAMLEKSRKRGAETEDGPRGSGHQMGDRFHKKARLLEIGRGSRGKGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.1
6 0.1
7 0.09
8 0.08
9 0.12
10 0.12
11 0.15
12 0.14
13 0.13
14 0.13
15 0.15
16 0.18
17 0.23
18 0.27
19 0.28
20 0.28
21 0.28
22 0.28
23 0.27
24 0.24
25 0.17
26 0.2
27 0.18
28 0.21
29 0.21
30 0.2
31 0.21
32 0.2
33 0.18
34 0.12
35 0.12
36 0.09
37 0.12
38 0.14
39 0.13
40 0.13
41 0.13
42 0.12
43 0.11
44 0.11
45 0.09
46 0.1
47 0.12
48 0.13
49 0.19
50 0.19
51 0.23
52 0.26
53 0.31
54 0.32
55 0.39
56 0.44
57 0.45
58 0.49
59 0.48
60 0.5
61 0.49
62 0.45
63 0.38
64 0.34
65 0.29
66 0.25
67 0.26
68 0.25
69 0.21
70 0.21
71 0.21
72 0.18
73 0.17
74 0.17
75 0.17
76 0.15
77 0.15
78 0.15
79 0.19
80 0.23
81 0.24
82 0.24
83 0.23
84 0.22
85 0.23
86 0.24
87 0.21
88 0.19
89 0.22
90 0.31
91 0.34
92 0.35
93 0.34
94 0.39
95 0.38
96 0.37
97 0.42
98 0.37
99 0.34
100 0.34
101 0.33
102 0.28
103 0.3
104 0.33
105 0.32
106 0.37
107 0.36
108 0.39
109 0.43
110 0.45
111 0.44
112 0.46
113 0.46
114 0.43
115 0.5
116 0.52
117 0.54
118 0.56
119 0.57
120 0.52
121 0.48
122 0.42
123 0.33
124 0.3
125 0.23
126 0.19
127 0.17
128 0.16
129 0.13
130 0.13
131 0.13
132 0.1
133 0.09
134 0.09
135 0.09
136 0.08
137 0.07
138 0.07
139 0.07
140 0.07
141 0.06
142 0.06
143 0.06
144 0.06
145 0.05
146 0.05
147 0.04
148 0.04
149 0.05
150 0.06
151 0.08
152 0.08
153 0.15
154 0.17
155 0.25
156 0.3
157 0.31
158 0.32
159 0.35
160 0.41
161 0.36
162 0.39
163 0.34
164 0.31
165 0.29
166 0.27
167 0.22
168 0.16
169 0.13
170 0.09
171 0.07
172 0.06
173 0.06
174 0.05
175 0.08
176 0.08
177 0.08
178 0.1
179 0.11
180 0.11
181 0.12
182 0.14
183 0.14
184 0.15
185 0.16
186 0.15
187 0.14
188 0.12
189 0.12
190 0.11
191 0.11
192 0.12
193 0.14
194 0.2
195 0.24
196 0.3
197 0.36
198 0.41
199 0.43
200 0.48
201 0.53
202 0.48
203 0.49
204 0.45
205 0.44
206 0.43
207 0.39
208 0.31
209 0.26
210 0.25
211 0.27
212 0.35
213 0.38
214 0.39
215 0.44
216 0.49
217 0.55
218 0.57
219 0.55
220 0.48
221 0.44
222 0.39
223 0.34
224 0.29
225 0.2
226 0.17
227 0.12
228 0.09
229 0.06
230 0.06
231 0.06
232 0.05
233 0.04
234 0.05
235 0.05
236 0.05
237 0.05
238 0.05
239 0.06
240 0.06
241 0.06
242 0.06
243 0.09
244 0.12
245 0.13
246 0.15
247 0.19
248 0.2
249 0.23
250 0.24
251 0.26
252 0.33
253 0.43
254 0.49
255 0.53
256 0.54
257 0.57
258 0.63
259 0.6
260 0.53
261 0.5
262 0.42
263 0.39
264 0.39
265 0.35
266 0.29
267 0.31
268 0.28
269 0.24
270 0.24
271 0.19
272 0.19
273 0.2
274 0.24
275 0.24
276 0.33
277 0.36
278 0.45
279 0.55
280 0.6
281 0.68
282 0.75
283 0.8
284 0.81
285 0.85
286 0.83
287 0.81
288 0.83
289 0.83
290 0.78
291 0.77
292 0.7
293 0.64
294 0.58
295 0.5
296 0.4
297 0.31
298 0.32
299 0.24
300 0.23
301 0.19
302 0.18
303 0.17
304 0.17
305 0.16
306 0.11
307 0.11
308 0.11
309 0.12
310 0.12
311 0.12
312 0.19
313 0.22
314 0.26
315 0.32
316 0.35
317 0.37
318 0.41
319 0.45
320 0.41
321 0.43
322 0.44
323 0.39
324 0.35
325 0.35
326 0.31
327 0.26
328 0.24
329 0.2
330 0.2
331 0.27
332 0.31
333 0.34
334 0.42
335 0.44
336 0.48
337 0.53
338 0.53
339 0.54
340 0.54
341 0.57
342 0.57
343 0.55
344 0.51
345 0.45
346 0.41
347 0.32
348 0.31
349 0.24
350 0.23
351 0.26
352 0.28
353 0.38
354 0.42
355 0.44
356 0.45
357 0.5
358 0.47
359 0.51
360 0.55
361 0.56
362 0.53
363 0.58
364 0.63
365 0.62
366 0.63
367 0.58
368 0.52