Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3ZEE5

Protein Details
Accession A0A2T3ZEE5    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
90-112KTDSCPMCGKPNKKSNPKAPTIDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 12.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019367  PDZ-binding_CRIPT  
Gene Ontology GO:0005737  C:cytoplasm  
Pfam View protein in Pfam  
PF10235  Cript  
Amino Acid Sequences MVCSKCLKLTKSTKLATPEVKKKSEMYYGSPASSKASGSKSATLGNTGVSKSKLLSKAAKNPYAAYSSSCTKCKTKITQGHSYCQKCAFKTDSCPMCGKPNKKSNPKAPTIDAYKNTLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.62
3 0.62
4 0.62
5 0.62
6 0.6
7 0.6
8 0.57
9 0.54
10 0.52
11 0.51
12 0.44
13 0.41
14 0.42
15 0.41
16 0.4
17 0.38
18 0.34
19 0.28
20 0.26
21 0.21
22 0.16
23 0.17
24 0.2
25 0.22
26 0.24
27 0.22
28 0.24
29 0.24
30 0.21
31 0.19
32 0.16
33 0.15
34 0.13
35 0.13
36 0.11
37 0.11
38 0.11
39 0.15
40 0.17
41 0.18
42 0.24
43 0.27
44 0.36
45 0.41
46 0.44
47 0.4
48 0.38
49 0.37
50 0.32
51 0.29
52 0.21
53 0.18
54 0.2
55 0.23
56 0.24
57 0.25
58 0.25
59 0.29
60 0.34
61 0.38
62 0.43
63 0.48
64 0.53
65 0.61
66 0.62
67 0.66
68 0.68
69 0.64
70 0.56
71 0.55
72 0.51
73 0.41
74 0.44
75 0.4
76 0.34
77 0.39
78 0.46
79 0.43
80 0.43
81 0.45
82 0.41
83 0.47
84 0.52
85 0.51
86 0.52
87 0.58
88 0.65
89 0.73
90 0.8
91 0.81
92 0.81
93 0.83
94 0.79
95 0.74
96 0.72
97 0.69
98 0.67
99 0.6