Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZLD2

Protein Details
Accession A0A2T3ZLD2   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
66-95IMLAKKEREGKGKKKKKKKKAATLVVELVHBasic
NLS Segment(s)
PositionSequence
70-86KKEREGKGKKKKKKKKA
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
Amino Acid Sequences MLIVLRTYNDRPYSETRSQKADGPSLVTATPTGPLCLTTYTRIPSCVHALAGGEKRLLPKAISFFIMLAKKEREGKGKKKKKKKKAATLVVELVHDMIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.54
3 0.5
4 0.53
5 0.53
6 0.53
7 0.5
8 0.46
9 0.38
10 0.33
11 0.31
12 0.26
13 0.25
14 0.19
15 0.16
16 0.12
17 0.13
18 0.1
19 0.1
20 0.08
21 0.09
22 0.09
23 0.11
24 0.12
25 0.12
26 0.14
27 0.16
28 0.17
29 0.18
30 0.18
31 0.18
32 0.2
33 0.18
34 0.15
35 0.13
36 0.13
37 0.15
38 0.16
39 0.14
40 0.11
41 0.11
42 0.12
43 0.13
44 0.14
45 0.1
46 0.11
47 0.13
48 0.14
49 0.15
50 0.14
51 0.13
52 0.18
53 0.2
54 0.18
55 0.19
56 0.2
57 0.21
58 0.28
59 0.31
60 0.35
61 0.42
62 0.52
63 0.6
64 0.69
65 0.77
66 0.82
67 0.9
68 0.91
69 0.94
70 0.94
71 0.94
72 0.94
73 0.95
74 0.91
75 0.88
76 0.82
77 0.72
78 0.61
79 0.49