Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3YZR0

Protein Details
Accession A0A2T3YZR0   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
56-78WVPGEVHKKKREKGTPQTQKKGRBasic
NLS Segment(s)
PositionSequence
61-78VHKKKREKGTPQTQKKGR
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MAAAPLVPLVPPLAKRASSAEPGQNPAVQLKSTRAHGRHEPDAKMRRGGSLSDRLWVPGEVHKKKREKGTPQTQKKGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.23
4 0.25
5 0.27
6 0.3
7 0.33
8 0.32
9 0.35
10 0.35
11 0.31
12 0.27
13 0.25
14 0.22
15 0.16
16 0.15
17 0.16
18 0.16
19 0.19
20 0.25
21 0.24
22 0.28
23 0.33
24 0.37
25 0.4
26 0.42
27 0.41
28 0.43
29 0.49
30 0.46
31 0.44
32 0.39
33 0.33
34 0.3
35 0.3
36 0.26
37 0.28
38 0.26
39 0.25
40 0.25
41 0.24
42 0.25
43 0.23
44 0.2
45 0.19
46 0.29
47 0.34
48 0.42
49 0.5
50 0.56
51 0.62
52 0.71
53 0.74
54 0.74
55 0.77
56 0.81
57 0.83
58 0.86