Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZL49

Protein Details
Accession A0A2T3ZL49   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
98-121PEDQDNQKSRRRRRVSYRPDRIYIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 7, cyto_nucl 6.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MTLCNSHRKRLRDSIQGVSMLLRLARRGGVARISNSIYDDMRNVLKEFLQQVIRDVVLYTEHRNAKTVTLHDVLHSLRRRGHTLYGFDQITWPESEDPEDQDNQKSRRRRRVSYRPDRIYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.63
3 0.59
4 0.51
5 0.41
6 0.34
7 0.24
8 0.2
9 0.13
10 0.1
11 0.1
12 0.1
13 0.11
14 0.12
15 0.14
16 0.19
17 0.21
18 0.22
19 0.24
20 0.25
21 0.24
22 0.23
23 0.23
24 0.17
25 0.14
26 0.13
27 0.12
28 0.13
29 0.13
30 0.13
31 0.11
32 0.11
33 0.13
34 0.13
35 0.14
36 0.15
37 0.14
38 0.15
39 0.15
40 0.15
41 0.13
42 0.12
43 0.09
44 0.09
45 0.1
46 0.1
47 0.15
48 0.17
49 0.17
50 0.19
51 0.19
52 0.19
53 0.2
54 0.19
55 0.18
56 0.18
57 0.18
58 0.17
59 0.19
60 0.17
61 0.22
62 0.24
63 0.21
64 0.23
65 0.25
66 0.28
67 0.28
68 0.34
69 0.32
70 0.34
71 0.35
72 0.37
73 0.35
74 0.32
75 0.31
76 0.25
77 0.22
78 0.18
79 0.16
80 0.12
81 0.12
82 0.16
83 0.16
84 0.19
85 0.2
86 0.22
87 0.22
88 0.28
89 0.35
90 0.37
91 0.44
92 0.5
93 0.57
94 0.65
95 0.72
96 0.75
97 0.79
98 0.85
99 0.89
100 0.9
101 0.91