Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZI58

Protein Details
Accession A0A2T3ZI58   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
82-101ESTCKHQPRQFNQSHPRRYAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, extr 6, mito_nucl 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MYFVDSKRAAISGVCLALCFVRCHAGLFSEWTRRVADAETERGHCKDVALSKTMIRWSSCSRMWHAAVILRAGPLENPTGQESTCKHQPRQFNQSHPRRYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.14
5 0.15
6 0.13
7 0.11
8 0.13
9 0.13
10 0.15
11 0.15
12 0.15
13 0.14
14 0.19
15 0.21
16 0.24
17 0.25
18 0.25
19 0.25
20 0.24
21 0.24
22 0.2
23 0.22
24 0.18
25 0.22
26 0.22
27 0.24
28 0.25
29 0.25
30 0.25
31 0.19
32 0.17
33 0.15
34 0.18
35 0.17
36 0.17
37 0.18
38 0.17
39 0.19
40 0.2
41 0.19
42 0.15
43 0.16
44 0.18
45 0.23
46 0.26
47 0.26
48 0.28
49 0.31
50 0.31
51 0.29
52 0.26
53 0.24
54 0.22
55 0.2
56 0.17
57 0.12
58 0.11
59 0.1
60 0.09
61 0.08
62 0.09
63 0.09
64 0.11
65 0.13
66 0.14
67 0.14
68 0.18
69 0.19
70 0.24
71 0.33
72 0.37
73 0.4
74 0.45
75 0.55
76 0.59
77 0.67
78 0.68
79 0.7
80 0.75
81 0.8