Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZC13

Protein Details
Accession A0A2T3ZC13    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
93-131GHTRLVQKRRHGWLKRTRSKTGRRILQRRKLKGRRHVAWBasic
NLS Segment(s)
PositionSequence
100-128KRRHGWLKRTRSKTGRRILQRRKLKGRRH
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MHSIIRLARPLLAPRISPLSQRTFSCLSPLRPTLTSTFRPNNSFTPSATAAAASPAETTATAADVVPKTALSMHPSLQGAMQLRFGPRNTMNGHTRLVQKRRHGWLKRTRSKTGRRILQRRKLKGRRHVAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.32
4 0.33
5 0.34
6 0.35
7 0.37
8 0.37
9 0.39
10 0.35
11 0.35
12 0.38
13 0.38
14 0.34
15 0.36
16 0.38
17 0.36
18 0.34
19 0.36
20 0.33
21 0.34
22 0.35
23 0.36
24 0.4
25 0.4
26 0.42
27 0.42
28 0.41
29 0.41
30 0.38
31 0.31
32 0.3
33 0.28
34 0.26
35 0.23
36 0.19
37 0.13
38 0.13
39 0.12
40 0.07
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.04
47 0.05
48 0.05
49 0.04
50 0.06
51 0.06
52 0.07
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.08
59 0.1
60 0.1
61 0.13
62 0.13
63 0.14
64 0.13
65 0.15
66 0.14
67 0.13
68 0.14
69 0.12
70 0.13
71 0.16
72 0.16
73 0.18
74 0.17
75 0.22
76 0.23
77 0.28
78 0.3
79 0.31
80 0.32
81 0.31
82 0.38
83 0.42
84 0.46
85 0.47
86 0.52
87 0.57
88 0.66
89 0.72
90 0.71
91 0.73
92 0.77
93 0.81
94 0.84
95 0.82
96 0.82
97 0.82
98 0.84
99 0.84
100 0.83
101 0.82
102 0.83
103 0.87
104 0.88
105 0.89
106 0.89
107 0.9
108 0.91
109 0.91
110 0.9
111 0.9