Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3Z129

Protein Details
Accession A0A2T3Z129   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-31KRNPGKPISQRQTRKKKNKRKLEGESKDKGNBasic
NLS Segment(s)
PositionSequence
5-41GKPISQRQTRKKKNKRKLEGESKDKGNKRQPRGQRSK
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences KRNPGKPISQRQTRKKKNKRKLEGESKDKGNKRQPRGQRSKSIPATEEAVYSRRSSRRAMGYQLWFLGDNGKACLVASSSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.93
4 0.93
5 0.95
6 0.94
7 0.93
8 0.93
9 0.93
10 0.91
11 0.88
12 0.84
13 0.79
14 0.77
15 0.7
16 0.67
17 0.66
18 0.65
19 0.63
20 0.66
21 0.69
22 0.72
23 0.78
24 0.76
25 0.76
26 0.73
27 0.75
28 0.71
29 0.63
30 0.53
31 0.44
32 0.41
33 0.32
34 0.27
35 0.18
36 0.16
37 0.15
38 0.15
39 0.19
40 0.19
41 0.21
42 0.23
43 0.28
44 0.35
45 0.37
46 0.42
47 0.45
48 0.46
49 0.45
50 0.43
51 0.38
52 0.3
53 0.27
54 0.25
55 0.19
56 0.16
57 0.15
58 0.15
59 0.14
60 0.13
61 0.14