Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3YQ95

Protein Details
Accession A0A2T3YQ95    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
58-78INKIIIKDIKKKYKIKKLLYIHydrophilic
NLS Segment(s)
PositionSequence
66-73IKKKYKIK
Subcellular Location(s) mito 14, nucl 8, cyto 3
Family & Domain DBs
Amino Acid Sequences LNNKLNFKKLKLFKILKKIKEVNYKLDLPNNIKLKITIFYILLLEKALINKKTGKLIINKIIIKDIKKKYKIKKLLYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.78
3 0.73
4 0.74
5 0.73
6 0.71
7 0.73
8 0.68
9 0.64
10 0.6
11 0.6
12 0.52
13 0.5
14 0.46
15 0.39
16 0.43
17 0.4
18 0.35
19 0.32
20 0.3
21 0.26
22 0.23
23 0.2
24 0.14
25 0.1
26 0.1
27 0.1
28 0.1
29 0.08
30 0.07
31 0.06
32 0.06
33 0.08
34 0.12
35 0.12
36 0.14
37 0.17
38 0.19
39 0.23
40 0.25
41 0.28
42 0.3
43 0.37
44 0.42
45 0.46
46 0.46
47 0.43
48 0.47
49 0.46
50 0.43
51 0.46
52 0.48
53 0.51
54 0.59
55 0.67
56 0.71
57 0.79
58 0.85