Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZBH7

Protein Details
Accession A0A2T3ZBH7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
274-345DDDRDRRDRRDRFDDRRDRGGSYRRREYSRSRSPRRDRERDRDRDYDRDDHRSRRKRSTSRERDRYDSDKRRBasic
NLS Segment(s)
PositionSequence
277-347RDRRDRRDRFDDRRDRGGSYRRREYSRSRSPRRDRERDRDRDYDRDDHRSRRKRSTSRERDRYDSDKRRKV
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033194  MFAP1  
IPR009730  MFAP1_C  
Pfam View protein in Pfam  
PF06991  MFAP1  
Amino Acid Sequences MRPKFIPKSQRGAAKSGDKEDEDARQQAEEEARKRAADELVEEQIKKDLAARAAGKKHWDDEENEESDVDTTDGLDPEAEEAAWRVRELKRLKRTRQAIEEREKELAEVERRRNLTEEERAAEDEAFLAKQKEEKEGKGKMSYMQKYYHKGAFFQEEAAAAGLLQRDIMGGRIQDDVRNREALPEYLQRRDMTKLGKKGATKYKDMRSEDTGRWGSFGGGGDRRRDDRNFDGDDRFRPDDDRFRSDGDGVKGANAIPLGDRRETRREDADRRGDDDRDRRDRRDRFDDRRDRGGSYRRREYSRSRSPRRDRERDRDRDYDRDDHRSRRKRSTSRERDRYDSDKRRKVDARE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.59
3 0.56
4 0.54
5 0.46
6 0.46
7 0.44
8 0.43
9 0.38
10 0.36
11 0.31
12 0.27
13 0.27
14 0.28
15 0.32
16 0.33
17 0.32
18 0.35
19 0.36
20 0.36
21 0.36
22 0.35
23 0.31
24 0.25
25 0.26
26 0.25
27 0.29
28 0.31
29 0.31
30 0.28
31 0.27
32 0.26
33 0.22
34 0.21
35 0.19
36 0.19
37 0.25
38 0.29
39 0.34
40 0.38
41 0.41
42 0.42
43 0.4
44 0.42
45 0.4
46 0.39
47 0.35
48 0.37
49 0.41
50 0.38
51 0.36
52 0.32
53 0.28
54 0.25
55 0.22
56 0.15
57 0.08
58 0.07
59 0.08
60 0.08
61 0.08
62 0.07
63 0.07
64 0.07
65 0.08
66 0.07
67 0.05
68 0.06
69 0.09
70 0.09
71 0.09
72 0.13
73 0.15
74 0.23
75 0.31
76 0.4
77 0.48
78 0.58
79 0.65
80 0.71
81 0.77
82 0.76
83 0.79
84 0.79
85 0.77
86 0.77
87 0.74
88 0.67
89 0.61
90 0.53
91 0.42
92 0.34
93 0.3
94 0.28
95 0.3
96 0.31
97 0.36
98 0.37
99 0.38
100 0.38
101 0.37
102 0.35
103 0.36
104 0.34
105 0.3
106 0.31
107 0.3
108 0.29
109 0.25
110 0.19
111 0.12
112 0.1
113 0.08
114 0.07
115 0.07
116 0.07
117 0.1
118 0.11
119 0.19
120 0.21
121 0.25
122 0.31
123 0.35
124 0.38
125 0.37
126 0.37
127 0.34
128 0.4
129 0.4
130 0.36
131 0.38
132 0.39
133 0.41
134 0.44
135 0.43
136 0.34
137 0.32
138 0.31
139 0.29
140 0.25
141 0.21
142 0.18
143 0.14
144 0.14
145 0.12
146 0.1
147 0.05
148 0.06
149 0.05
150 0.04
151 0.04
152 0.04
153 0.03
154 0.04
155 0.05
156 0.05
157 0.05
158 0.06
159 0.08
160 0.08
161 0.11
162 0.14
163 0.16
164 0.17
165 0.18
166 0.17
167 0.17
168 0.18
169 0.17
170 0.17
171 0.21
172 0.22
173 0.23
174 0.25
175 0.23
176 0.24
177 0.25
178 0.25
179 0.26
180 0.3
181 0.33
182 0.35
183 0.38
184 0.38
185 0.43
186 0.49
187 0.45
188 0.45
189 0.47
190 0.5
191 0.55
192 0.56
193 0.52
194 0.49
195 0.51
196 0.46
197 0.47
198 0.42
199 0.33
200 0.31
201 0.28
202 0.22
203 0.18
204 0.18
205 0.13
206 0.16
207 0.18
208 0.2
209 0.23
210 0.25
211 0.28
212 0.28
213 0.3
214 0.31
215 0.35
216 0.37
217 0.38
218 0.41
219 0.4
220 0.41
221 0.42
222 0.38
223 0.32
224 0.3
225 0.31
226 0.34
227 0.37
228 0.4
229 0.35
230 0.36
231 0.37
232 0.36
233 0.37
234 0.3
235 0.27
236 0.21
237 0.2
238 0.18
239 0.17
240 0.16
241 0.11
242 0.09
243 0.08
244 0.11
245 0.14
246 0.16
247 0.18
248 0.22
249 0.3
250 0.34
251 0.36
252 0.42
253 0.47
254 0.51
255 0.58
256 0.63
257 0.58
258 0.58
259 0.57
260 0.51
261 0.51
262 0.53
263 0.53
264 0.54
265 0.56
266 0.59
267 0.66
268 0.7
269 0.71
270 0.73
271 0.74
272 0.73
273 0.79
274 0.84
275 0.79
276 0.81
277 0.75
278 0.67
279 0.65
280 0.65
281 0.63
282 0.62
283 0.66
284 0.63
285 0.66
286 0.68
287 0.71
288 0.71
289 0.73
290 0.75
291 0.76
292 0.81
293 0.86
294 0.92
295 0.92
296 0.93
297 0.91
298 0.91
299 0.92
300 0.91
301 0.88
302 0.87
303 0.82
304 0.8
305 0.76
306 0.75
307 0.69
308 0.69
309 0.68
310 0.69
311 0.74
312 0.75
313 0.76
314 0.78
315 0.83
316 0.83
317 0.88
318 0.89
319 0.9
320 0.91
321 0.94
322 0.89
323 0.86
324 0.83
325 0.81
326 0.8
327 0.8
328 0.79
329 0.78
330 0.74
331 0.77