Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZFJ7

Protein Details
Accession A0A2T3ZFJ7   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
44-69SGVQISLRRRHRPRRLRRYPAASKDFHydrophilic
NLS Segment(s)
PositionSequence
51-63RRRHRPRRLRRYP
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, mito 8, cyto 6.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYPFASIPSSIYSLARRKGCRFDMQKATSVRTYLDIVPALAYYSGVQISLRRRHRPRRLRRYPAASKDFLAAGRKWNSSLTQRQRKLRLFIRIDITFPPLPLLFSFFSISIPHLDPQQHASII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.4
3 0.42
4 0.45
5 0.53
6 0.56
7 0.6
8 0.6
9 0.62
10 0.65
11 0.63
12 0.64
13 0.58
14 0.57
15 0.49
16 0.43
17 0.35
18 0.26
19 0.26
20 0.2
21 0.19
22 0.16
23 0.14
24 0.13
25 0.13
26 0.11
27 0.08
28 0.07
29 0.05
30 0.06
31 0.05
32 0.05
33 0.05
34 0.09
35 0.15
36 0.24
37 0.3
38 0.38
39 0.47
40 0.57
41 0.68
42 0.75
43 0.8
44 0.83
45 0.87
46 0.88
47 0.87
48 0.86
49 0.84
50 0.82
51 0.75
52 0.65
53 0.55
54 0.47
55 0.4
56 0.32
57 0.27
58 0.18
59 0.19
60 0.21
61 0.21
62 0.21
63 0.21
64 0.23
65 0.26
66 0.35
67 0.4
68 0.47
69 0.53
70 0.6
71 0.68
72 0.69
73 0.71
74 0.68
75 0.67
76 0.61
77 0.59
78 0.59
79 0.51
80 0.48
81 0.41
82 0.4
83 0.31
84 0.26
85 0.24
86 0.17
87 0.17
88 0.16
89 0.19
90 0.14
91 0.15
92 0.17
93 0.14
94 0.15
95 0.15
96 0.16
97 0.16
98 0.17
99 0.16
100 0.19
101 0.2
102 0.21
103 0.25